Cyclophilin A Protein, Mouse (His)

Cyclophilin A (PPIA) protein, with integrin binding and peptidyl-prolyl cis-trans isomerase activity, influences platelet aggregation and neuron differentiation. It is found in the extracellular space and myelin sheath, showing ubiquitous expression in various tissues, including the liver and central nervous system. PPIA is associated with cholangiocarcinoma and HIV disease, suggesting its role in fundamental cellular processes. Cyclophilin A Protein, Mouse (His) is the recombinant mouse-derived Cyclophilin A protein, expressed by E. coli , with C-His labeled tag.

Cyclophilin A (PPIA) protein exhibits integrin binding activity and peptidyl-prolyl cis-trans isomerase activity. This versatile protein is involved in platelet aggregation and plays a role upstream of processes related to neuron differentiation. Cyclophilin A is located in the extracellular space and the myelin sheath, contributing to its functional diversity. The gene encoding this protein shows ubiquitous expression in various tissues, including the liver, central nervous system, and numerous other structures during early developmental stages. Implications of the human ortholog PPIA include its association with cholangiocarcinoma and human immunodeficiency virus infectious disease. This broad expression pattern suggests Cyclophilin A's involvement in fundamental cellular processes across multiple tissues.

Measured by its ability to inhibit calcineurin phosphatase activity in the presence of Cyclosporin A. The IC₅₀ for inhibition of calcineurin activity is 432.059 nM that incubate at 37 ºC for 60 minutes.

Mouse

E. coli

C-His

P17742/NP_032933.1 (M1-L164)

268373  [NCBI]

Full Length

MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL

Approximately 18.94 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution.

1.Supplied as a 0.22 μm filtered solution of PBS, 10% glycerol, pH 7.4.
2.Supplied as a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 10% glycerol, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.