Cyclophilin A Protein, Mouse (His)

Customer Review

Based on 1 Customer Validation

Cyclophilin A (PPIA) protein, with integrin binding and peptidyl-prolyl cis-trans isomerase activity, influences platelet aggregation and neuron differentiation. It is found in the extracellular space and myelin sheath, showing ubiquitous expression in various tissues, including the liver and central nervous system. PPIA is associated with cholangiocarcinoma and HIV disease, suggesting its role in fundamental cellular processes. Cyclophilin A Protein, Mouse (His) is the recombinant mouse-derived Cyclophilin A protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Cyclophilin A (PPIA) protein, with integrin binding and peptidyl-prolyl cis-trans isomerase activity, influences platelet aggregation and neuron differentiation. It is found in the extracellular space and myelin sheath, showing ubiquitous expression in various tissues, including the liver and central nervous system. PPIA is associated with cholangiocarcinoma and HIV disease, suggesting its role in fundamental cellular processes. Cyclophilin A Protein, Mouse (His) is the recombinant mouse-derived Cyclophilin A protein, expressed by E. coli , with C-His labeled tag.

Background

Cyclophilin A (PPIA) protein exhibits integrin binding activity and peptidyl-prolyl cis-trans isomerase activity. This versatile protein is involved in platelet aggregation and plays a role upstream of processes related to neuron differentiation. Cyclophilin A is located in the extracellular space and the myelin sheath, contributing to its functional diversity. The gene encoding this protein shows ubiquitous expression in various tissues, including the liver, central nervous system, and numerous other structures during early developmental stages. Implications of the human ortholog PPIA include its association with cholangiocarcinoma and human immunodeficiency virus infectious disease. This broad expression pattern suggests Cyclophilin A's involvement in fundamental cellular processes across multiple tissues.

Verified Bioactivity

Measured by its ability to inhibit calcineurin phosphatase activity in the presence of Cyclosporin A. The IC50 for inhibition of calcineurin activity is 432.059 nM that incubate at 37 ºC for 60 minutes.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Cyclophilin A (M1-L164)
      Accession # P17742/NP_032933.1
    • His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    PPIA; Epididymis Secretory Sperm Binding Protein Li 69p; Peptidylprolyl Isomerase A; Peptidylprolyl Isomerase A (Cyclophilin A); CYPA; Peptidyl-Prolyl Cis-Trans Isomerase; Peptidyl-Prolyl Cis-Trans Isomerase A; T Cell Cyclophilin; Cyclosporin A-Binding Pr

  • AA Sequence

    MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of PBS, 10% glycerol, pH 7.4.
2.Supplied as a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 10% glycerol, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00