1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. Cyclophilin A Protein, Mouse (His)

Cyclophilin A Protein, Mouse (His)

Cat. No.: HY-P74212
COA Handling Instructions

Cyclophilin A (PPIA) protein, with integrin binding and peptidyl-prolyl cis-trans isomerase activity, influences platelet aggregation and neuron differentiation. It is found in the extracellular space and myelin sheath, showing ubiquitous expression in various tissues, including the liver and central nervous system. PPIA is associated with cholangiocarcinoma and HIV disease, suggesting its role in fundamental cellular processes. Cyclophilin A Protein, Mouse (His) is the recombinant mouse-derived Cyclophilin A protein, expressed by E. coli , with C-His labeled tag. The total length of Cyclophilin A Protein, Mouse (His) is 164 a.a., with molecular weight of ~18.94 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $45 In-stock
10 μg $78 In-stock
50 μg $228 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cyclophilin A (PPIA) protein, with integrin binding and peptidyl-prolyl cis-trans isomerase activity, influences platelet aggregation and neuron differentiation. It is found in the extracellular space and myelin sheath, showing ubiquitous expression in various tissues, including the liver and central nervous system. PPIA is associated with cholangiocarcinoma and HIV disease, suggesting its role in fundamental cellular processes. Cyclophilin A Protein, Mouse (His) is the recombinant mouse-derived Cyclophilin A protein, expressed by E. coli , with C-His labeled tag. The total length of Cyclophilin A Protein, Mouse (His) is 164 a.a., with molecular weight of ~18.94 kDa.

Background

Cyclophilin A (PPIA) protein exhibits integrin binding activity and peptidyl-prolyl cis-trans isomerase activity. This versatile protein is involved in platelet aggregation and plays a role upstream of processes related to neuron differentiation. Cyclophilin A is located in the extracellular space and the myelin sheath, contributing to its functional diversity. The gene encoding this protein shows ubiquitous expression in various tissues, including the liver, central nervous system, and numerous other structures during early developmental stages. Implications of the human ortholog PPIA include its association with cholangiocarcinoma and human immunodeficiency virus infectious disease. This broad expression pattern suggests Cyclophilin A's involvement in fundamental cellular processes across multiple tissues.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

NP_032933.1 (M1-L164)

Gene ID

268373  [NCBI]

Molecular Construction
N-term
Cyclophilin A (M1-L164)
Accession # NP_032933.1
His
C-term
Synonyms
Peptidyl-prolyl cis-trans isomerase A; PPIase A; SP18; PPIA; CYPA
AA Sequence

MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL

Molecular Weight

Approximately 18.94 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4, 10% glycerol or 20 mM PB, 150 mM NaCl, 10% Glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Cyclophilin A Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cyclophilin A Protein, Mouse (His)
Cat. No.:
HY-P74212
Quantity:
MCE Japan Authorized Agent: