Cystatin C/CST3 Protein, Rat (HEK293, His)

Cystatin C/CST3 protein is a vital regulator of cysteine proteinases, inhibiting enzymes like cathepsin B, H, and L to ensure proper enzyme activity.Its role as a local regulator underscores its significance in various biological processes.Cystatin C/CST3 Protein, Rat (HEK293, His) is the recombinant rat-derived Cystatin C/CST3 protein, expressed by HEK293 , with C-His labeled tag.

Cystatin C, also known as CST3 protein, is a crucial regulator of cysteine proteinases. This protein acts as an inhibitor, specifically targeting enzymes such as cathepsin B, H, and L, to maintain proper enzyme activity. Its physiological role as a local regulator highlights its significance in various biological processes.

Measured by its ability to inhibit papain cleavage of a fluorogenic peptide substrate Z-FR-AMC. Read at excitation and emission wavelengths of 380 nm and 460 nm (top read). The IC₅₀ value is 5.37 nM. (Activation description: The proenzyme needs to be activated in reducing buffer for an activated form.)

Rat

HEK293

C-His

P14841 (G21-A140)

25307  [NCBI]

Full Length

GTSRPPPRLLGAPQEADASEEGVQRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGINYYLDVEMGRTTCTKSQTNLTNCPFHDQPHLMRKALCSFQIYSVPWKGTHTLTKSSCKNA

16-25 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM HEPES, 150 mM NaCl, pH 7.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.