Cystatin C/CST3 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
Cystatin C/CST3 protein is a vital regulator of cysteine proteinases, inhibiting enzymes like cathepsin B, H, and L to ensure proper enzyme activity.Its role as a local regulator underscores its significance in various biological processes.Cystatin C/CST3 Protein, Rat (HEK293, His) is the recombinant rat-derived Cystatin C/CST3 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Cystatin C/CST3 protein is a vital regulator of cysteine proteinases, inhibiting enzymes like cathepsin B, H, and L to ensure proper enzyme activity.Its role as a local regulator underscores its significance in various biological processes.Cystatin C/CST3 Protein, Rat (HEK293, His) is the recombinant rat-derived Cystatin C/CST3 protein, expressed by HEK293 , with C-His labeled tag.
Background
Cystatin C, also known as CST3 protein, is a crucial regulator of cysteine proteinases. This protein acts as an inhibitor, specifically targeting enzymes such as cathepsin B, H, and L, to maintain proper enzyme activity. Its physiological role as a local regulator highlights its significance in various biological processes.
Verified Bioactivity
Measured by its ability to inhibit papain cleavage of a fluorogenic peptide substrate Z-FR-AMC. Read at excitation and emission wavelengths of 380 nm and 460 nm (top read). The IC50 value is 5.37 nM. (Activation description: The proenzyme needs to be activated in reducing buffer for an activated form.)
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
P14841 (G21-A140)
-
Molecular Construction
-
N-term
-
CST3 (G21-A140)
Accession # P14841 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
CST3; Cystatin C (Amyloid Angiopathy And Cerebral Hemorrhage); Cystatin C; BA218C14.4 (Cystatin C); Epididymis Secretory Protein Li 2; Cystatin 3; Neuroendocrine Basic Polypeptide; Cystatin-3; Post-Gamma-Globulin; HEL-S-2; Gamma-Trace; ADLDWA; Cystatin-C;
-
AA Sequence
GTSRPPPRLLGAPQEADASEEGVQRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGINYYLDVEMGRTTCTKSQTNLTNCPFHDQPHLMRKALCSFQIYSVPWKGTHTLTKSSCKNA
-
Molecular Weight
Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of 20 mM HEPES, 150 mM NaCl, pH 7.0.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
