1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Cystatin F/CST7 Protein, Human (HEK293, His)

Cystatin F/CST7 Protein, Human (HEK293, His)

Cat. No.: HY-P7851
Handling Instructions

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $165 Ask For Quote & Lead Time
50 μg $496 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Cystatin F/CST7 Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products

Cystatin F/CST7 Protein, Human (HEK293, His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

HEK 293

Accession

O76096 (G20-H145)

Gene ID

8530

Synonyms
rHuCystatin-F/CST7, His; Cystatin-F; Cystatin-7; Cystatin-Like Metastasis-Associated Protein; CMAP; Leukocystatin; CST7
AA Sequence

GPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH

Molecular Weight

19-25 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cystatin F/CST7 Protein, Human (HEK293, His)
Cat. No.:
HY-P7851
Quantity:
MCE Japan Authorized Agent: