1. Protéines recombinantes
  2. Enzymes & Regulators
  3. Protease Inhibitors Cystatin Family
  4. Cystatin F
  5. Cystatin F/CST7 Protein, Human (HEK293, His)

Cystatin F/CST7 is a protein that acts as an inhibitor of papain and cathepsin L, but with lower affinity than other cystatins. It plays a potential role in immunomodulation by targeting specific components within the hematopoietic system. Cystatin F/CST7 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin F/CST7 protein, expressed by HEK293 , with C-6*His labeled tag.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Prix Stock Quantité
10 μg En stock
50 μg En stock
100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Cystatin F/CST7 Protein, Human (HEK293, His) Recommandations en vedette:

Top Publications Citing Use of Products
  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

Description

Cystatin F/CST7 is a protein that acts as an inhibitor of papain and cathepsin L, but with lower affinity than other cystatins. It plays a potential role in immunomodulation by targeting specific components within the hematopoietic system. Cystatin F/CST7 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin F/CST7 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Cystatin F/CST7 is a protein that functions as an inhibitor of papain and cathepsin L, albeit with lower affinities compared to other cystatins. It exhibits a potential role in immune regulation by targeting a specific component within the hematopoietic system. The protein forms stable homodimers through disulfide linkages, contributing to its structural stability. Understanding the inhibitory properties and homodimeric structure of Cystatin F/CST7 is crucial for unraveling its involvement in regulating immune responses and potentially exploring its therapeutic applications in conditions where papain and cathepsin L activities need to be controlled.

Activité biologique

1. Measured by its ability to inhibit active Cathepsin L cleavage of 10µM fluorogenic peptidesubstrate Z-LR-AMC.(HY-142021) that incubate at room temperature in kinetic mode for 5 minutes. The IC50 value is 2.267 nM. (Activation description: The proenzyme needs to be activated in acid reducing bufferr for an activated form.)
2. Measured by its ability to inhibit active Cathepsin L cleavage of 20µM fluorogenic peptidesubstrate Z-LR-AMC.(HY-142021) that incubate at room temperature in kinetic mode for 5 minutes. The IC50 value is 34.25 nM. (Activation description: The proenzyme needs to be activated in acid reducing bufferr for an activated form.)

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O76096 (G20-H145)

Gene ID
Molecular Construction
N-term
CST7 (G20-H145)
Accession # O76096
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuCystatin-F/CST7, His; Cystatin-F; Cystatin-7; Cystatin-Like Metastasis-Associated Protein; CMAP; Leukocystatin; CST7
AA Sequence

GPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH

Masse moléculaire

19-25 kDa

Glycosylation
Yes
Pureté

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Livraison

Room temperature in continental US; may vary elsewhere.

Documentation

Cystatin F/CST7 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

Cystatin F/CST7 Protein, Human (HEK293, His)

 

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

     

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
Cystatin F/CST7 Protein, Human (HEK293, His)
Cat. No.:
HY-P7851
Quantité:
MCE Japan Authorized Agent: