Cystatin F/CST7 Protein, Human (HEK293, His)

Cystatin F/CST7 is a protein that acts as an inhibitor of papain and cathepsin L, but with lower affinity than other cystatins. It plays a potential role in immunomodulation by targeting specific components within the hematopoietic system. Cystatin F/CST7 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin F/CST7 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Cystatin F/CST7 Protein, Human (HEK293, His) is 126 a.a., with molecular weight of 19-25 kDa.

Cystatin F/CST7 is a protein that functions as an inhibitor of papain and cathepsin L, albeit with lower affinities compared to other cystatins. It exhibits a potential role in immune regulation by targeting a specific component within the hematopoietic system. The protein forms stable homodimers through disulfide linkages, contributing to its structural stability. Understanding the inhibitory properties and homodimeric structure of Cystatin F/CST7 is crucial for unraveling its involvement in regulating immune responses and potentially exploring its therapeutic applications in conditions where papain and cathepsin L activities need to be controlled.

Human

HEK293

C-6*His

O76096 (G20-H145)

8530  [NCBI]

GPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH

19-25 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.