1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors Cystatin Family
  4. Cystatin F
  5. Cystatin F/CST7 Protein, Mouse (HEK293, His)

Cystatin F/CST7 Protein, Mouse (HEK293, His)

Cat. No.: HY-P7853
Handling Instructions

Cystatin F/CST7 Protein inhibits papain and cathepsin L, showing lower affinities compared to other cystatins. Notably, its distinct feature is its potential role in immune regulation, inhibiting a unique target within the hematopoietic system. This specialization implies Cystatin F/CST7's involvement in modulating immune responses within the complex regulatory network of hematopoiesis. Cystatin F/CST7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cystatin F/CST7 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Cystatin F/CST7 Protein, Mouse (HEK293, His) is 126 a.a., with molecular weight of ~18.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cystatin F/CST7 Protein inhibits papain and cathepsin L, showing lower affinities compared to other cystatins. Notably, its distinct feature is its potential role in immune regulation, inhibiting a unique target within the hematopoietic system. This specialization implies Cystatin F/CST7's involvement in modulating immune responses within the complex regulatory network of hematopoiesis. Cystatin F/CST7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cystatin F/CST7 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Cystatin F/CST7 Protein, Mouse (HEK293, His) is 126 a.a., with molecular weight of ~18.0 kDa.

Background

Cystatin F/CST7 protein serves as an inhibitor of papain and cathepsin L, albeit with affinities lower than other cystatins. Its distinctive feature lies in its potential role in immune regulation, where it acts by inhibiting a unique target within the hematopoietic system. This suggests that Cystatin F/CST7 may play a specialized role in modulating immune responses, contributing to the intricate regulatory network governing proteolytic activities in the context of hematopoiesis.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

O89098 (A19-Q144)

Gene ID

13011  [NCBI]

Molecular Construction
N-term
CST7 (A19-Q144)
Accession # O89098
6*His
C-term
Synonyms
rMuCystatin-F/CST7, His; Cystatin-F; Cystatin-like Metastasis-Associated Protein; Leukocystatin; CMAP; Cystatin-7; Cst7;
AA Sequence

ARPPDFCSKDLISSVKPGFPKTIETNNPGVLKAARHSVEKFNNCTNDIFLFKESHVSKALVQVVKGLKYMLEVKIGRTTCRKTMHHQLDNCDFQTNPALKRTLYCYSEVWVIPWLHSFEVPVLLCQ

Molecular Weight

Approximately 18.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Cystatin F/CST7 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cystatin F/CST7 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7853
Quantity:
MCE Japan Authorized Agent: