Cystatin F/CST7 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
Cystatin F/CST7 Protein inhibits papain and cathepsin L, showing lower affinities compared to other cystatins. Notably, its distinct feature is its potential role in immune regulation, inhibiting a unique target within the hematopoietic system. This specialization implies Cystatin F/CST7's involvement in modulating immune responses within the complex regulatory network of hematopoiesis. Cystatin F/CST7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cystatin F/CST7 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
보관:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Cystatin F/CST7 Protein inhibits papain and cathepsin L, showing lower affinities compared to other cystatins. Notably, its distinct feature is its potential role in immune regulation, inhibiting a unique target within the hematopoietic system. This specialization implies Cystatin F/CST7's involvement in modulating immune responses within the complex regulatory network of hematopoiesis. Cystatin F/CST7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cystatin F/CST7 protein, expressed by HEK293 , with C-6*His labeled tag.
Cystatin F/CST7 protein serves as an inhibitor of papain and cathepsin L, albeit with affinities lower than other cystatins. Its distinctive feature lies in its potential role in immune regulation, where it acts by inhibiting a unique target within the hematopoietic system. This suggests that Cystatin F/CST7 may play a specialized role in modulating immune responses, contributing to the intricate regulatory network governing proteolytic activities in the context of hematopoiesis.
Measured by its ability to inhibit active Cathepsin L cleavage of 10µM fluorogenic peptidesubstrate Z-LR-AMC (HY-142021) that incubate at room temperature in kinetic mode for 5 minutes. The IC50 value is 2.833 nM. (Activation description: The proenzyme needs to be activated in acid reducing buffer for an activated form.)
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
O89098 (A19-Q144)
-
Molecular Construction
-
N-term
-
CST7 (A19-Q144)
Accession # O89098 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
rMuCystatin-F/CST7, His; Cystatin-F; Cystatin-like Metastasis-Associated Protein; Leukocystatin; CMAP; Cystatin-7; Cst7;
-
AA Sequence
ARPPDFCSKDLISSVKPGFPKTIETNNPGVLKAARHSVEKFNNCTNDIFLFKESHVSKALVQVVKGLKYMLEVKIGRTTCRKTMHHQLDNCDFQTNPALKRTLYCYSEVWVIPWLHSFEVPVLLCQ
-
Predicted Molecular Mass
15.4 kDa
-
분자량
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
N/A.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
각종 서류
-
Data Sheet (260 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)