Cystatin M/CST6 Protein, Human (HEK293, His)

Cystatin M/CST6 protein is a potent inhibitor of cathepsin L, cathepsin L2 (cathepsin V) and Legumain, regulating important proteolytic processes. It actively participates in epidermal keratinization and affects the formation of the skin barrier. Cystatin M/CST6 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin M/CST6 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Cystatin M/CST6 Protein, Human (HEK293, His) is 121 a.a., with molecular weight of ~14.0-19.0 kDa.

Cystatin M/CST6 Protein serves as a high-affinity inhibitor for cathepsin L, cathepsin L2 (cathepsin V), and legumain, highlighting its role in modulating key proteolytic processes. Beyond its inhibitory function, this protein is actively involved in the regulation of epidermal cornification, contributing to the intricate processes of skin barrier formation. Additionally, Cystatin M/CST6 plays a significant role in hair follicle morphogenesis and maintenance, further underscoring its importance in fundamental aspects of skin biology and homeostasis. The dual functionality of Cystatin M/CST6 in enzyme inhibition and the regulation of skin development emphasizes its multifaceted role in maintaining the integrity and function of cutaneous tissues.

Human

HEK293

C-6*His

Q15828 (R29-M149)

1474  [NCBI]

RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM

Approximately 14.0-19.0 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.