1. Recombinant Proteins
  2. Others
  3. DKK-1 Protein, Mouse (CHO)

DKK-1 Protein, Mouse (CHO)

Cat. No.: HY-P7154
COA Handling Instructions

Dkk-1 Protein, Mouse (CHO) is shown to be a potent inhibitor of Wnt signaling and member of dickkopf family.

For research use only. We do not sell to patients.

Size Price Stock Quantity
10 μg $190 In-stock
50 μg $620 In-stock
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Dkk-1 Protein, Mouse (CHO) is shown to be a potent inhibitor of Wnt signaling and member of dickkopf family.

Background

Mature mouse Dkk-1 is a 40 kDa glycosylated protein that shares 86%, 96%, 83% and 82% amino acid (aa) sequence identity with human, rat, rabbit and bovine Dkk-1, respectively. It also shares 41% and 36% aa identity with human Dkk-2 and Dkk-4, respectively[1]. Dkk1 is a secreted Wnt inhibitor and member of a distinct multigene family, this inhibition plays a key role in heart, head and forelimb development during anterior morphogenesis of the embryo[2][3].

Biological Activity

The ED50 is <6 μg/mL as measured in stimulation of alkaline phosphatase activity using CCl-226 cells.

Species

Mouse

Source

CHO

Tag

Tag Free

Accession

O54908 (S30-H272)

Gene ID

13380  [NCBI]

Synonyms
rMuDKK-1; mDkk-1; Dickkopf-1
AA Sequence

SATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQAS

Molecular Weight

19-20 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

DKK-1 Protein, Mouse (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DKK-1 Protein, Mouse (CHO)
Cat. No.:
HY-P7154
Quantity:
MCE Japan Authorized Agent: