Copy Link Print Information

DKK-1 Protein, Human (HEK293, Fc)

5 Cited Publications
Customer Review

Based on 5 publication(s) in Google Scholar

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity.DKK-1 Protein, Human (HEK293, Fc) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, Fc)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, Fc)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, Fc)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, Fc)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, Fc)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, Fc)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, Fc)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, Fc)
  • DKK-1 Protein, Human (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity.DKK-1 Protein, Human (HEK293, Fc) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

DKK1 protein functions as a potent antagonist of canonical Wnt signaling through multiple mechanisms. It inhibits the interaction between LRP5/6 and Wnt and forms a ternary complex with the transmembrane protein KREMEN, facilitating the internalization of LRP5/6. Notably, DKK1 not only antagonizes the pro-apoptotic function of KREMEN1 in a Wnt-independent manner but also exhibits anti-apoptotic activity. The protein is implicated in limb development, where it modulates Wnt signaling to ensure normal limb patterning. Through its C-terminal Cys-rich domain, DKK1 interacts with LRP5 and LRP6, specifically engaging with beta-propeller regions 3 and 4 of LRP5. This interaction is further influenced by MESD and/or KREMEN, collectively leading to the attenuation of Wnt-mediated signaling. Additionally, DKK1 forms a ternary complex with LRP6 and KREM1, highlighting its multifaceted role in regulating crucial cellular processes and interactions with key proteins involved in Wnt signaling.

Verified Bioactivity

1. Human LRP-6 (HY-P77990) immobilized on CM5 Chip can bind Human DKK-1 with an affinity constant of 1.574 nM as determined in a SPR assay.
2. Measured by its ability to inhibit Wnt3a induced alkaline phosphatase production by C3H10T1/2 cells. The ED50 for this effect is approximately 0.2181 μg/mL in the presence of 10 ng/mL of Wnt3a, corresponding to a specific activity is 4585.053 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - SPR

    Bioactivity - SPR

    Human LRP-6 (HY-P77990) immobilized on CM5 Chip can bind Human DKK-1 with an affinity constant of 1.574 nM as determined in a SPR assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession

    O94907 (T32-H266)

  • Gene ID
    22943  [NCBI]
  • Molecular Construction
    • N-term
    • DKK-1 (T32-H266)
      Accession # O94907
    • hFc
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    DKK1; Dickkopf 1 Homolog (Xenopus Laevis); Dickkopf Wnt Signaling Pathway Inhibitor 1; Dickkopf 1 Homolog; SK; Dickkopf-1 Like; DKK-1; Dickkopf-1; Dickkopf-Related Protein 1; HDkk-1; Dickkopf-Like Protein 1; Dkk-1; Dickkopf (Xenopus Laevis) Homolog 1

  • AA Sequence

    TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

  • Molecular Weight

    Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Human LRP-6 (HY-P77990) immobilized on CM5 Chip can bind Human DKK-1 with an affinity constant of 1.574 nM as determined in a SPR assay.

  • 1/16

    DKK-1 Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Exp Cell Res. 2024 Jul 15;440(2):114139. [Abstract]

    Customer Validation
     The vaginal fibroblasts from women without POP were subjected to 0.6 μM H2O2 for 24 h in the presence and absence of a Wnt signaling inhibitor DKK-1 Protein, Human (HEK293, Fc) (DKK-1, 0.5 μg/mL; 24 h). Expression of collagen I, collagen III, MMP9 and TIMP1 protein in the vaginal fibroblasts derived from women without POP by Western blot. The results showed that ECM deposition caused by CSRNP1 knockdown was curbed after treatment with the Wnt pathway inhibitor DKK1.

  • 1/16

    DKK-1 Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Oral Dis. 2024 Apr;30(3):1429-1438. [Abstract]

    Customer Validation
     Effects of crocin on the activation of WNT/β-catenin signaling during osteogenic differentiation of PDLSCs. PDLSCs were divided into three treatment groups as follows: Control, crocin, and crocin + DKK-1 Protein, Human (HEK293, Fc) (DKK1, 100 nM; 7 days). Western blotting was performed to determine the protein expression of β-catenin, c-Myc and cyclin D1 after 7 days of treatment. β-Actin served as the loading control. The results showed that supplementation with the Wnt pathway inhibitor DKK1 partially reversed the promotive effects of crocin on the protein expression of β-catenin and cyclin D1.

  • 1/16

    DKK-1 Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Mech Ageing Dev. 2023 Apr:211:111789. [Abstract]

    Customer Validation
     Adenovirus GFP-LC3 was used to detect the formation of autophagosome under Ang-II (1 μM), α-Klotho (400 pM), DKK-1 Protein, Human (HEK293, Fc) (DKK-1, 500 pM) and Wnt3a (1 nM) treatment for 72 h. Fluorescent puncta analysis exhibited that Klotho and DKK-1 promoted the formation of autophagosomes, as shown by an increase in green puncta; Klotho also relieved the inhibition of Wnt3a on autophagosome formation.

  • 1/16

    DKK-1 Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Mech Ageing Dev. 2023 Apr:211:111789. [Abstract]

    Customer Validation
     SA-β-Gal staining positive cells were counted and analyzed under Ang-II (1 μM), α-Klotho (400 pM), DKK-1 Protein, Human (HEK293, Fc) (DKK-1, 500 pM) and Wnt3a (1 nM) treatment for 72 h. The results showed that DKK-1 reduced the Ang-II-induced proportion of SA-β-gal-positive cells.

  • 1/16

    DKK-1 Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Mech Ageing Dev. 2023 Apr:211:111789. [Abstract]

    Customer Validation
     Cell viability was measured by CCK-8 assay under Ang-II (1 μM), α-Klotho (400 pM), DKK-1 Protein, Human (HEK293, Fc) (DKK-1, 500 pM) and Wnt3a (1 nM) treatment for 72 h. The results showed that DKK-1 reduced the Ang-II-induced inhibition of cell viability.

  • 1/16

    DKK-1 Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Mech Ageing Dev. 2023 Apr:211:111789. [Abstract]

    Customer Validation
     Western blotting was used to analyze the effect of Ang-II (1 μM), α-Klotho (400 pM), DKK-1 Protein, Human (HEK293, Fc) (DKK-1, 500 pM) and Wnt3a (1 nM) treatment for 72 h on the levels of P53 and P16.

  • DKK-1 Protein, Human (HEK293, Fc) Product Image
    1/16
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, Fc)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, Fc)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, Fc)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, Fc)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, Fc)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, Fc)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, Fc)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, Fc)
  • DKK-1 Protein, Human (HEK293, Fc) Product Image

  • DKK-1 Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Exp Cell Res. 2024 Jul 15;440(2):114139. [Abstract]

    The vaginal fibroblasts from women without POP were subjected to 0.6 μM H2O2 for 24 h in the presence and absence of a Wnt signaling inhibitor DKK-1 Protein, Human (HEK293, Fc) (DKK-1, 0.5 μg/mL; 24 h). Expression of collagen I, collagen III, MMP9 and TIMP1 protein in the vaginal fibroblasts derived from women without POP by Western blot. The results showed that ECM deposition caused by CSRNP1 knockdown was curbed after treatment with the Wnt pathway inhibitor DKK1.

  • DKK-1 Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Oral Dis. 2024 Apr;30(3):1429-1438. [Abstract]

    Effects of crocin on the activation of WNT/β-catenin signaling during osteogenic differentiation of PDLSCs. PDLSCs were divided into three treatment groups as follows: Control, crocin, and crocin + DKK-1 Protein, Human (HEK293, Fc) (DKK1, 100 nM; 7 days). Western blotting was performed to determine the protein expression of β-catenin, c-Myc and cyclin D1 after 7 days of treatment. β-Actin served as the loading control. The results showed that supplementation with the Wnt pathway inhibitor DKK1 partially reversed the promotive effects of crocin on the protein expression of β-catenin and cyclin D1.

  • DKK-1 Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Mech Ageing Dev. 2023 Apr:211:111789. [Abstract]

    Adenovirus GFP-LC3 was used to detect the formation of autophagosome under Ang-II (1 μM), α-Klotho (400 pM), DKK-1 Protein, Human (HEK293, Fc) (DKK-1, 500 pM) and Wnt3a (1 nM) treatment for 72 h. Fluorescent puncta analysis exhibited that Klotho and DKK-1 promoted the formation of autophagosomes, as shown by an increase in green puncta; Klotho also relieved the inhibition of Wnt3a on autophagosome formation.

  • DKK-1 Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Mech Ageing Dev. 2023 Apr:211:111789. [Abstract]

    SA-β-Gal staining positive cells were counted and analyzed under Ang-II (1 μM), α-Klotho (400 pM), DKK-1 Protein, Human (HEK293, Fc) (DKK-1, 500 pM) and Wnt3a (1 nM) treatment for 72 h. The results showed that DKK-1 reduced the Ang-II-induced proportion of SA-β-gal-positive cells.

  • DKK-1 Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Mech Ageing Dev. 2023 Apr:211:111789. [Abstract]

    Cell viability was measured by CCK-8 assay under Ang-II (1 μM), α-Klotho (400 pM), DKK-1 Protein, Human (HEK293, Fc) (DKK-1, 500 pM) and Wnt3a (1 nM) treatment for 72 h. The results showed that DKK-1 reduced the Ang-II-induced inhibition of cell viability.

  • DKK-1 Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Mech Ageing Dev. 2023 Apr:211:111789. [Abstract]

    Western blotting was used to analyze the effect of Ang-II (1 μM), α-Klotho (400 pM), DKK-1 Protein, Human (HEK293, Fc) (DKK-1, 500 pM) and Wnt3a (1 nM) treatment for 72 h on the levels of P53 and P16.