DNAM-1 Protein, Human (HEK293, Fc)

DNAM-1 protein is a key player in cell-cell adhesion and lymphocyte signaling, mediating cytotoxicity and lymphokine secretion of CTL and NK cells. As a receptor for NECTIN2, DNAM-1 stimulates T cell proliferation and cytokine production (IL2, IL5, IL10, IL13, and IFNG) upon ligand binding. DNAM-1 Protein, Human (HEK293, Fc) is the recombinant human-derived DNAM-1 protein, expressed by HEK293 , with C-hFc labeled tag.

The DNAM-1 protein is intricately involved in intercellular adhesion, lymphocyte signaling, cytotoxicity, and lymphokine secretion mediated by cytotoxic T-lymphocytes (CTL) and natural killer (NK) cells. Serving as a cell surface receptor for NECTIN2, DNAM-1, upon ligand binding, stimulates T-cell proliferation and the production of cytokines such as IL2, IL5, IL10, IL13, and IFNG. Furthermore, DNAM-1 competes with PVRIG for NECTIN2-binding, underscoring its regulatory role in cellular interactions and signaling pathways. This protein also interacts with PVR and NECTIN2, contributing to its multifaceted functions in immune responses and cellular communication.

Human

HEK293

C-hFc

Q15762 (E19-N247)

10666  [NCBI]

Partial

EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN

72-90 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.