DR3/TNFRSF25 Protein, Human (Biotinylated, HEK293, Fc)

DR3/TNFRSF25 Protein, the receptor for TNFSF12/APO3L/TWEAK, interacts with adapter TRADD, activating NF-kappa-B and inducing apoptosis. It may crucially regulate lymphocyte homeostasis. Forming homodimers, it strongly interacts with TNFRSF1 and TRADD via death domains, initiating distinct apoptosis and NF-kappa-B signaling cascades. Interaction with BAG4 contributes to its multifaceted cellular response roles. DR3/TNFRSF25 Protein, Human (Biotinylated, HEK293, Fc) is the recombinant human-derived DR3/TNFRSF25 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of DR3/TNFRSF25 Protein, Human (Biotinylated, HEK293, Fc) is 175 a.a., with molecular weight of ~45.9 KDa.

DR3/TNFRSF25 Protein serves as the receptor for TNFSF12/APO3L/TWEAK and directly interacts with the adapter TRADD. This interaction leads to the activation of NF-kappa-B and induction of apoptosis. The protein may play a crucial role in regulating lymphocyte homeostasis. It forms homodimers and exhibits strong interactions via the death domains with TNFRSF1 and TRADD, initiating distinct signaling cascades involved in apoptosis and NF-kappa-B signaling. Additionally, DR3/TNFRSF25 interacts with BAG4, contributing to its multifaceted roles in cellular responses.

Human

HEK293

C-hFc

Q93038 (Q25-Q199)

8718  [NCBI]

QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ

Approximately 45.9 kDa.

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.