TL1A/TNFSF15 Protein, Human
Based on 1 Customer Validation
TL1A/TNFSF15 Protein, the receptor for TNFRSF25 and TNFRSF6B, activates NF-kappa-B and promotes caspase activation, leading to apoptosis. It also inhibits vascular endothelial growth and angiogenesis in vitro. Operating as a homotrimer, it plays a crucial role in diverse cellular processes, including immune response and apoptosis regulation. TL1A/TNFSF15 Protein, Human is the recombinant human-derived TL1A/TNFSF15 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TL1A/TNFSF15 Protein, the receptor for TNFRSF25 and TNFRSF6B, activates NF-kappa-B and promotes caspase activation, leading to apoptosis. It also inhibits vascular endothelial growth and angiogenesis in vitro. Operating as a homotrimer, it plays a crucial role in diverse cellular processes, including immune response and apoptosis regulation. TL1A/TNFSF15 Protein, Human is the recombinant human-derived TL1A/TNFSF15 protein, expressed by E. coli , with tag free.
Background
TL1A/TNFSF15 Protein acts as the receptor for TNFRSF25 and TNFRSF6B, facilitating the activation of NF-kappa-B and promoting the activation of caspases, leading to apoptosis. Additionally, it exhibits inhibitory effects on vascular endothelial growth and angiogenesis in vitro. The protein functions as a homotrimer, underscoring its role in diverse cellular processes, including immune response and apoptosis regulation.
Verified Bioactivity
1. Measured by its ability to induce apoptosis of TF-1 human erythroleukemic cells. The ED50 for this effect is 3-15 ng/mL.
2. Loaded Tulisokibart (HY-P990007) on AHC2 biosensor, can bind TL1A/TNFSF15 Protein, Human with an affinity constant of 3.693E-10 M as determined in BLI assay.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
-
Bioactivity - BLI
Bioactivity - BLI
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O95150-1 (L72-L251)
-
Molecular Construction
-
N-term
-
TL1A (L72-L251)
Accession # O95150 -
C-term
-
-
Protein Length
Full Length of Tumor necrosis factor ligand superfamily member 15, secreted form Chain
-
Synonyms
TNFSF15; TL1A; TNF Superfamily Member 15; Vascular Endothelial Growth Inhibitor-192A; Vascular Endothelial Cell Growth Inhibitor; Vascular Endothelial Growth Inhibitor; TNF Ligand-Related Molecule 1; TNF Superfamily Ligand TL1A; VEGI; MGC129934; TL1; MGC1
-
AA Sequence
LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
-
Predicted Molecular Mass
20.5 kDa
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)