1. Recombinant Proteins
  2. Viral Proteins
  3. Ebola Virus Proteins
  4. Ebola Viral Protein 24
  5. Ebola virus VP24 Protein (YP_003815439, His)

Ebola virus VP24 Protein (YP_003815439, His) is the recombinant Virus-derived Ebola virus VP24 protein, expressed by E. coli, with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ebola virus VP24 Protein (YP_003815439, His) is the recombinant Virus-derived Ebola virus VP24 protein, expressed by E. coli, with N-His labeled tag.

Background

Ebola virus (EBOV) possesses a single-stranded, negative sense RNA genome of approximately 19 kilobases that encodes seven structural proteins: the nucleoprotein (NP), VP35, VP40, the glycoprotein (GP), VP30, VP24, and the RNA-dependent RNA polymerase L[1]. VP24 is one of two proteins of the ebolaviruses that can antagonize IFN responses (the other is VP35). VP24 inhibits signaling downstream of IFNα/β and IFNγ, by trapping karyopherin α proteins (α1, α5 and α6) in the cytoplasm, and prevents them from shuttling otherwise activated, phosphorylated STAT1 to the nucleus. VP24 also prevents phosphorylation of p38 MAPK[2][3]. Besides, the interaction between NP and VP24 is essential for nucleocapsid formation and packaging into the virion[1]. VP24 is a critical target in the development of anti-EBOV agents.

Species

Virus

Source

E. coli

Tag

N-His

Accession

YP_003815439.1 (M1-K233)

Gene ID

9487267  [NCBI]

Molecular Construction
N-term
His
EBOV VP24 (M1-K233)
Accession # YP_003815439.1
C-term
Protein Length

Partial

Synonyms
Ebola virus EBOV (subtype Bundibugyo, strain Uganda 2007) VP24 Protein; VP24 Protein; EBOV
AA Sequence

MAKATGRYNLVSPKKDLERGLVLSDLCTFLVDQTIQGWRVTWVGIEFDIAQKGMALLHRLKTADFAPAWSMTRNLFPHLFQNSNSTIESPLWALRVILAAGIQDQLIDQSLVEPLAGALSLVSDWLLTTNTNHFQMRTQHAKEQLSLKMLSLVRSNILKFISQLDALHVVNYNGLLSSIEIGTRNHTIIITRTNMGFLVELQEPDKSAMNQKKPGPVKFSLLHESTFKALIKK

Predicted Molecular Mass
28.5 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Ebola virus VP24 Protein (YP_003815439, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Ebola virus VP24 Protein (YP_003815439, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ebola virus VP24 Protein (YP_003815439, His)
Cat. No.:
HY-P76309
Quantity:
MCE Japan Authorized Agent: