EGF Protein, Mouse

EGF Protein, Mouse is a growth factor that stimulates the proliferation of the epidermis and several epithelial tissues.

Epidermal growth factor (EGF) binds to epidermal growth factor receptor and stimulates an intracellular signal transduction cascade, leading to activation of genes that regulate cell proliferation, angiogenesis, motility, and metastasis^[1]. Epidermal growth factor (EGF) is initially synthesized as a large precursor of 1217 amino acids that is glycosylated and can be secreted by cells. Epidermal growth factor (EGF) mRNA and protein are expressed in a number of adult tissues, especially in epithelial cells in the gastrointestinal tract. Predominant sites of synthesis of this peptide are the submandibular glands, the Brunner glands in the small intestine and the kidney^[2].

The ED₅₀ is <0.1 ng/mL as measured by BALB/c 3T3 cells, corresponding to a specific activity of >1.0 × 10⁷ units/mg.

Mouse

E. coli

Tag Free

P01132 (N977-R1029)

13645  [NCBI]

MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Approximately 6.2 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Hynes NE, et al. ERBB receptors and cancer: the complexity of targeted inhibitors. Nat Rev Cancer. 2005 May;5(5):341-54.  [Content Brief]

  [2]. Salomon DS, et al. Epidermal growth factor-related peptides and their receptors in human malignancies. Crit Rev Oncol Hematol. 1995 Jul;19(3):183-232.  [Content Brief]