1. Recombinant Proteins
  2. Cytokines and Growth Factors CAR-T Related Proteins Receptor Proteins Enzymes & Regulators
  3. EGF Superfamily Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. EGFR/ErbB family
  5. EGFR
  6. EGFR vIII Protein, Human (HEK293, His)

EGFR vIII Protein, Human (HEK293, His)

Cat. No.: HY-P70189
COA Handling Instructions

The EGFRvIII protein is a transmembrane glycoprotein in the protein kinase superfamily that acts as a receptor for epidermal growth factor. It acts on the cell surface, binds to epidermal growth factor, triggers receptor dimerization and tyrosine autophosphorylation, and promotes cell proliferation. EGFR vIII Protein, Human (HEK293, His) is the recombinant human-derived EGFR vIII protein, expressed by HEK293 , with C-6*His labeled tag. The total length of EGFR vIII Protein, Human (HEK293, His) is 354 a.a., with molecular weight of 61-75 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $107 In-stock
50 μg $300 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EGFRvIII protein is a transmembrane glycoprotein in the protein kinase superfamily that acts as a receptor for epidermal growth factor. It acts on the cell surface, binds to epidermal growth factor, triggers receptor dimerization and tyrosine autophosphorylation, and promotes cell proliferation. EGFR vIII Protein, Human (HEK293, His) is the recombinant human-derived EGFR vIII protein, expressed by HEK293 , with C-6*His labeled tag. The total length of EGFR vIII Protein, Human (HEK293, His) is 354 a.a., with molecular weight of 61-75 kDa.

Background

The EGFRvIII protein is a transmembrane glycoprotein belonging to the protein kinase superfamily and serves as a receptor for members of the epidermal growth factor family. Operating as a cell surface protein, EGFRvIII binds to epidermal growth factor, initiating receptor dimerization and tyrosine autophosphorylation, thereby promoting cell proliferation. Mutations in this gene are associated with lung cancer. Furthermore, EGFRvIII is implicated as a component of the cytokine storm, contributing to the severity of Coronavirus Disease 2019 (COVID-19) caused by infection with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2). [provided by RefSeq, Jul 2020]

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

NP_001333870 (L25-S378)

Gene ID
Molecular Construction
N-term
EGFR vIII (L25-S378)
Accession # NP_001333870
6*His
C-term
Synonyms
rHuEpidermal Growth Factor Receptor/EGFR vIII, His; Epidermal growth factor receptor; EGFR; Proto-oncogene c-ErbB-1; Receptor tyrosine-protein kinase erbB-1; EGFR
AA Sequence

LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPS

Molecular Weight

61-75 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EGFR vIII Protein, Human (HEK293, His)
Cat. No.:
HY-P70189
Quantity:
MCE Japan Authorized Agent: