Copy Link Print Information

Elafin/Trappin-2 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Elafin/Trappin-2, a skin-specific inhibitor of neutrophil and pancreatic elastase, safeguards tissues against elastase-mediated proteolysis. Its inhibitory range extends to the alpha-4-beta-2/CHRNA2-CHRNB2 nicotinic acetylcholine receptor. Elafin/Trappin-2 also weakly inhibits Kv11.1/KCNH2/ERG1 and transient receptor potential cation channel subfamily V member 1 (TRPV1), as reported in studies. Elafin/Trappin-2 Protein, Human (HEK293, His) is the recombinant human-derived Elafin/Trappin-2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for Elafin/Trappin-2 Protein, Human (HEK293, His)
  • Elafin/Trappin-2 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Elafin/Trappin-2, a skin-specific inhibitor of neutrophil and pancreatic elastase, safeguards tissues against elastase-mediated proteolysis. Its inhibitory range extends to the alpha-4-beta-2/CHRNA2-CHRNB2 nicotinic acetylcholine receptor. Elafin/Trappin-2 also weakly inhibits Kv11.1/KCNH2/ERG1 and transient receptor potential cation channel subfamily V member 1 (TRPV1), as reported in studies. Elafin/Trappin-2 Protein, Human (HEK293, His) is the recombinant human-derived Elafin/Trappin-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Elafin/Trappin-2, identified as a neutrophil and pancreatic elastase-specific inhibitor primarily found in the skin, serves as a protective factor against elastase-mediated tissue proteolysis. Its inhibitory properties extend beyond proteases, as it has demonstrated the ability to inhibit the alpha-4-beta-2/CHRNA2-CHRNB2 nicotinic acetylcholine receptor. Additionally, Elafin/Trappin-2 exerts a weak inhibitory effect on Kv11.1/KCNH2/ERG1 and the transient receptor potential cation channel subfamily V member 1 (TRPV1), as documented in studies.

Verified Bioactivity

The inhibitory activity of the product has not been validated. (Activation description: The proenzyme needs to be activated by Cathepsin C, Mouse (HY-P704018) for an activated form.)

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P19957 (A23-Q117)

  • Gene ID
    5266  [NCBI]
  • Molecular Construction
    • N-term
    • Elafin (A23-Q117)
      Accession # P19957
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PI3; WAP Four-Disulfide Core Domain Protein 14; Peptidase Inhibitor 3; Peptidase Inhibitor 3, Skin-Derived; WFDC14; Elastase-Specific Inhibitor; SKALP; Protease Inhibitor WAP3; WAP3; Trappin-2; ESI; PI-3; Skin-Derived Antileukoproteinase; WAP Four-Disulfi

  • AA Sequence

    AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

  • Predicted Molecular Mass

    11 kDa

  • Molecular Weight

    Approximately 13-18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • Elafin/Trappin-2 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Elafin/Trappin-2 Protein, Human (HEK293, His)
  • Elafin/Trappin-2 Protein, Human (HEK293, His) Product Image