envelope glycoprotein gp160 Protein, HIV-1 (ADD25380, HEK293, His)

Envelope glycoprotein gp160 Protein (HIV-1 gp160 Protein) is the sole antigenic protein on the surface of the HIV-1 virion and mediates HIV-1 entry into target cells. The endoproteolytic processing of HIV-1 gp160 membrane glycoprotein precursor into gp120 and gp41 is necessary for formation of infectious HIV particles. HIV-1 gp160 induces endothelial cell apoptosis, which is mediated by CXCR4 chemokine receptor^[1][2][3][4]. envelope glycoprotein gp160 Protein, HIV-1 (ADD25380, HEK293, His) is the recombinant Virus-derived envelope glycoprotein gp160 protein, expressed by HEK293 , with C-His labeled tag.

HIV-1 envelope glycoprotein is synthesized as a precursor glycoprotein, gp160, and is then processed into gp120 and gp41^[2]. Envelope glycoprotein gp160 Protein (HIV-1 gp160 Protein) is the sole antigenic protein on the surface of the HIV-1 virion and mediates HIV-1 entry into target cells^[1]. Noticeably, endoproteolytic processing of HIV-1 gp160 membrane glycoprotein precursor into gp120 and gp41 is necessary for formation of infectious HIV particles^[3]. HIV-1 gp160 induces endothelial cell apoptosis and activates caspase-3, which is mediated by CXCR4 chemokine receptor^[4].

Virus

HEK293

C-His

ADD25380 (W32-R504)

/

Full Length of GP120

WVTVYYGVPVWRDAETILFCASDAKAHSTEAHNIWATQACVPTDPNPQEVELPNVTEYFNMWENKMADQMQEDIVSLWEQSLKPCVKLTPLCVTMNCTDSNGNVTKNEKKTANTTTSTGNISAEDLEEKHMKNCSFNATTEVTDKQKKVYSLFYAEDVIPLSNATDNKDYRLISCXTTVVTQACPKITFEPIPIHYCAPPGFAIMKCREGNFXGKGDCKNVSTVQCTHGIKPVISTHLALNGSLADDIVVRNNSGNMLVQWXETVSINCTRPGNNTGGQVQIGPAMTFYNIEKIIGDIRQAHCIVSRKDWESMWNKTKAKIKETLGENITFRARKKNEGDPEVXNLMFNCHGEFFYCNTSKLFDEXQNKTNXTITLPCRIKQIVNLWTRVGKGIYAPPIRGNLTCHSNITGLILEYSEDXKDGTGTNTTVYPSGGNMVDLWRQELHKYKVVSIEPIGVAPGKAKRRTVSREKR

54.4 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.