1. Recombinant Proteins
  2. Viral Proteins
  3. HIV Proteins
  4. HIV-1 gp160
  5. envelope glycoprotein gp160 Protein, HIV-1 (ADD25380, HEK293, His)

envelope glycoprotein gp160 Protein, HIV-1 (ADD25380, HEK293, His)

Cat. No.: HY-P76383
Handling Instructions Technical Support

Envelope glycoprotein gp160 Protein (HIV-1 gp160 Protein) is the sole antigenic protein on the surface of the HIV-1 virion and mediates HIV-1 entry into target cells. The endoproteolytic processing of HIV-1 gp160 membrane glycoprotein precursor into gp120 and gp41 is necessary for formation of infectious HIV particles. HIV-1 gp160 induces endothelial cell apoptosis, which is mediated by CXCR4 chemokine receptor. envelope glycoprotein gp160 Protein, HIV-1 (ADD25380, HEK293, His) is the recombinant Virus-derived envelope glycoprotein gp160 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Envelope glycoprotein gp160 Protein (HIV-1 gp160 Protein) is the sole antigenic protein on the surface of the HIV-1 virion and mediates HIV-1 entry into target cells. The endoproteolytic processing of HIV-1 gp160 membrane glycoprotein precursor into gp120 and gp41 is necessary for formation of infectious HIV particles. HIV-1 gp160 induces endothelial cell apoptosis, which is mediated by CXCR4 chemokine receptor[1][2][3][4]. envelope glycoprotein gp160 Protein, HIV-1 (ADD25380, HEK293, His) is the recombinant Virus-derived envelope glycoprotein gp160 protein, expressed by HEK293 , with C-His labeled tag.

Background

HIV-1 envelope glycoprotein is synthesized as a precursor glycoprotein, gp160, and is then processed into gp120 and gp41[2]. Envelope glycoprotein gp160 Protein (HIV-1 gp160 Protein) is the sole antigenic protein on the surface of the HIV-1 virion and mediates HIV-1 entry into target cells[1]. Noticeably, endoproteolytic processing of HIV-1 gp160 membrane glycoprotein precursor into gp120 and gp41 is necessary for formation of infectious HIV particles[3]. HIV-1 gp160 induces endothelial cell apoptosis and activates caspase-3, which is mediated by CXCR4 chemokine receptor[4].

Species

Virus

Source

HEK293

Tag

C-His

Accession

ADD25380 (W32-R504)

Gene ID

/

Molecular Construction
N-term
HIV-1 gp160 (W32-R504)
Accession # ADD25380
His
C-term
Protein Length

Full Length of GP120

Synonyms
HIV-1 gp160 Protein (gp120 subunit) (group N, strain 06CM-U14296)
AA Sequence

WVTVYYGVPVWRDAETILFCASDAKAHSTEAHNIWATQACVPTDPNPQEVELPNVTEYFNMWENKMADQMQEDIVSLWEQSLKPCVKLTPLCVTMNCTDSNGNVTKNEKKTANTTTSTGNISAEDLEEKHMKNCSFNATTEVTDKQKKVYSLFYAEDVIPLSNATDNKDYRLISCXTTVVTQACPKITFEPIPIHYCAPPGFAIMKCREGNFXGKGDCKNVSTVQCTHGIKPVISTHLALNGSLADDIVVRNNSGNMLVQWXETVSINCTRPGNNTGGQVQIGPAMTFYNIEKIIGDIRQAHCIVSRKDWESMWNKTKAKIKETLGENITFRARKKNEGDPEVXNLMFNCHGEFFYCNTSKLFDEXQNKTNXTITLPCRIKQIVNLWTRVGKGIYAPPIRGNLTCHSNITGLILEYSEDXKDGTGTNTTVYPSGGNMVDLWRQELHKYKVVSIEPIGVAPGKAKRRTVSREKR

Predicted Molecular Mass
54.4 kDa
Molecular Weight

54.4 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

envelope glycoprotein gp160 Protein, HIV-1 (ADD25380, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

envelope glycoprotein gp160 Protein, HIV-1 (ADD25380, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
envelope glycoprotein gp160 Protein, HIV-1 (ADD25380, HEK293, His)
Cat. No.:
HY-P76383
Quantity:
MCE Japan Authorized Agent: