EphA7 Protein, Mouse (HEK293, His)

The EphA7 protein is a receptor tyrosine kinase that participates in bidirectional signaling with GPI-anchored ephrin-A ligands (especially EFNA5). It affects brain development by regulating intercellular adhesion and repulsion, contributing to axonal guidance of corticothalamic and retinal axons. EphA7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA7 protein, expressed by HEK293 , with C-His labeled tag.

EphA7 protein, a receptor tyrosine kinase, binds to GPI-anchored ephrin-A ligands on neighboring cells, initiating contact-dependent bidirectional signaling. This receptor is involved in forward signaling, while the ephrin ligand triggers reverse signaling. Among the ephrin-A ligands, EFNA5 specifically interacts with EphA7, regulating brain development by influencing cell-cell adhesion and repulsion. EphA7 also plays a crucial role in axon guidance, ensuring the proper mapping of corticothalamic and retinal axons. Additionally, EphA7 may contribute to brain development through its proapoptotic activity, which depends on caspase (CASP3). Activation of EphA7 can lead to phosphorylation of components of the ERK signaling pathway, including MAP2K1, MAP2K2, MAPK1, and MAPK3. Isoform 4, lacking the kinase domain, may also regulate the adhesive properties of isoform 1.

1.This product does not contain protein kinase domain.
2.Measured by its binding ability in a functional ELISA. Immobilized Mouse EphA7 at 2 μg/mL (100 μL/well) can bind biotinylated Mouse Ephrin-A4. The ED₅₀ for this effect is ≤45.87 ng/mL.
3.Measured by its binding ability in a functional ELISA. Immobilized Mouse EphA7 at 10 μg/mL (100 μL/well) can bind biotinylated Mouse Ephrin-A4. The ED₅₀ for this effect is ≤21 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Mouse EphA7 at 10 μg/mL (100 μL/well) can bind biotinylated Mouse Ephrin-A4. The ED₅₀ for this effect is 20.7 ng/mL.

Mouse

HEK293

C-10*His

Q61772 (Q28-I556)

13841  [NCBI]

Partial

QAAKEVLLLDSKAQQTELEWISSPPSGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIVENLAVFPDTVTGSEFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRRFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVQLSWQEPEHPNGVITEYEIKYYEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRAVTAAGYGNYSPRLDVATLEEASGKMFEATAVSSEQNPVI

Approximately 68-77 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.