EphA7 Protein, Rat (HEK293, Fc)

The EphA7 protein is a receptor tyrosine kinase that participates in bidirectional signaling with GPI-anchored ephrin A ligands (such as EFNA5). It affects brain development by regulating cell-cell adhesion and repulsion. EphA7 Protein, Rat (HEK293, Fc) is the recombinant rat-derived EphA7 protein, expressed by HEK293 , with C-hFc labeled tag.

EphA7 protein is a receptor tyrosine kinase that interacts with GPI-anchored ephrin-A ligands on adjacent cells, initiating bidirectional signaling. This contact-dependent signaling, known as forward signaling, occurs downstream of the receptor, while reverse signaling occurs downstream of the ephrin ligand. Among the ephrin-A ligands, EFNA5 specifically interacts with EphA7, influencing brain development by modulating cell-cell adhesion and repulsion. EphA7 also plays a role in axon guidance, facilitating the proper mapping of corticothalamic and retinal axons. Additionally, EphA7 may contribute to brain development through a proapoptotic activity that depends on caspase (CASP3). Activation of EphA7 can lead to phosphorylation of components of the ERK signaling pathway, including MAP2K1, MAP2K2, MAPK1, and MAPK3.

Rat

HEK293

C-hFc

P54759-1 (Q28-S539)

171287  [NCBI]

Partial

QAAKEVLLLDSKAQQTELEWISSPPSGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAVFPDTVTGSEFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRRFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEAS

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.