Ephrin-A4/EFNA4 Protein, Mouse (150a.a, HEK293, Fc)

Ephrin-A4/EFNA4 proteins are cell surface GPI-binding ligands of Eph receptors that serve as critical mediators in a variety of cellular processes critical for migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. As a promiscuous binder, Ephrin-A4 binds to Eph receptors on neighboring cells, stimulating contact-dependent bidirectional signaling to neighboring cells. Ephrin-A4/EFNA4 Protein, Mouse (150a.a, HEK293, Fc) is the recombinant mouse-derived Ephrin-A4/EFNA4 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Ephrin-A4/EFNA4 Protein, Mouse (150a.a, HEK293, Fc) is 150 a.a., with molecular weight of ~53.0 kDa.

Ephrin-A4 (EFNA4) is a cell surface glycosylphosphatidylinositol (GPI)-bound ligand that belongs to the Eph receptor family, a group of receptor tyrosine kinases crucial for various developmental processes, including migration, repulsion, and adhesion in neurons, vascular tissues, and epithelial cells. EFNA4 binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling into neighboring cells. This interaction is essential for orchestrating complex cellular events during development. Moreover, EFNA4 may contribute to the interaction between activated B-lymphocytes and dendritic cells in tonsils, suggesting its involvement in immune responses.

Mouse

HEK293

C-hFc

O08542 (R27-G176)

13639  [NCBI]

RHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPHYESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTPFPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESG

Approximately 53.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.