MAPK1/ERK2 Protein, Human (Active, sf9, His)
Based on 1 publication(s) in Google Scholar
ERK2 Protein, a key component of the MAPK/ERK cascade, regulates diverse cellular processes such as transcription, translation, mitosis, apoptosis, endosomal dynamics, and Golgi apparatus fragmentation. Through phosphorylation, it modulates substrates including transcription factors, cytoskeletal elements, apoptosis regulators, translation regulators, protein kinases, and phosphatases. MAPK1/ERK2 Protein, Human (sf9, His) is the recombinant human-derived ERK2 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
ERK2 Protein, a key component of the MAPK/ERK cascade, regulates diverse cellular processes such as transcription, translation, mitosis, apoptosis, endosomal dynamics, and Golgi apparatus fragmentation. Through phosphorylation, it modulates substrates including transcription factors, cytoskeletal elements, apoptosis regulators, translation regulators, protein kinases, and phosphatases. MAPK1/ERK2 Protein, Human (sf9, His) is the recombinant human-derived ERK2 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
The MAPK/ERK cascade plays a crucial role in the regulation of various cellular processes, including transcription, translation, mitosis, apoptosis, endosomal dynamics, and Golgi apparatus fragmentation. It achieves this by phosphorylating a multitude of substrates, including transcription factors, cytoskeletal elements, regulators of apoptosis, regulators of translation, protein kinases, and phosphatases.
Verified Bioactivity
Measured by its ability to catalyze 250 μg/mL substrate MBP that incubate at room temperature for 60 minutes. The specific activity is 42.52 nmol/min/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
J Med Chem
Platinum-Paeonol Complexes as ERK Inhibitors To Restrain Melanoma and Relieve Cancer Pain. [Abstract]2026 Apr 9;69(7):7663-7676. PMID: 41873204
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-8*His
-
Accession
P28482-1 (M1-S360)
-
Molecular Construction
-
N-term
-
MAPK1/ERK2 (M1-S360)
Accession # P28482-1 -
8*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
MAPK1; MAPK 2; Prev. PRKM1; ERT1; Prev. PRKM2; Mitogen-Activated Protein Kinase; ERK2; Protein Tyrosine Kinase ERK2; Extracellular Signal-Regulated Kinase 2; MAP Kinase Isoform P42; P41mapk; P42MAPK; MAPK2; MAPK 1; ERK; NS13; Mitogen-Activated Protein Kin
-
AA Sequence
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
-
Predicted Molecular Mass
42.9 kDa
-
Molecular Weight
Approximately 43 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM Nacl, 10% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)