ERK2 Protein, Human (sf9, His)

ERK2 Protein, a key component of the MAPK/ERK cascade, regulates diverse cellular processes such as transcription, translation, mitosis, apoptosis, endosomal dynamics, and Golgi apparatus fragmentation. Through phosphorylation, it modulates substrates including transcription factors, cytoskeletal elements, apoptosis regulators, translation regulators, protein kinases, and phosphatases. ERK2 Protein, Human (sf9, His) is the recombinant human-derived ERK2 protein, expressed by Sf9 insect cells , with C-His labeled tag. The total length of ERK2 Protein, Human (sf9, His) is 360 a.a., with molecular weight of ~42 kDa.

The MAPK/ERK cascade plays a crucial role in the regulation of various cellular processes, including transcription, translation, mitosis, apoptosis, endosomal dynamics, and Golgi apparatus fragmentation. It achieves this by phosphorylating a multitude of substrates, including transcription factors, cytoskeletal elements, regulators of apoptosis, regulators of translation, protein kinases, and phosphatases.

No Kinase Activity

Human

Sf9 insect cells

C-His

P28482 (M1-S360)

5594  [NCBI]

MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Approximately 42 kDa

Greater than 95% as determined by reducing SDS-PAGE

Solution

Supplied as 0.22 μm filtered solution in 20 mM Tris, 500 mM Nacl, 10% glycerol (pH 8.0).

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.