1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. ERK2 Protein, Human (sf9, His)

ERK2 Protein, Human (sf9, His)

Cat. No.: HY-P75223
COA Handling Instructions

ERK2 Protein, a key component of the MAPK/ERK cascade, regulates diverse cellular processes such as transcription, translation, mitosis, apoptosis, endosomal dynamics, and Golgi apparatus fragmentation. Through phosphorylation, it modulates substrates including transcription factors, cytoskeletal elements, apoptosis regulators, translation regulators, protein kinases, and phosphatases. ERK2 Protein, Human (sf9, His) is the recombinant human-derived ERK2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $60 In-stock
10 μg $100 In-stock
50 μg $280 In-stock
100 μg $475 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ERK2 Protein, a key component of the MAPK/ERK cascade, regulates diverse cellular processes such as transcription, translation, mitosis, apoptosis, endosomal dynamics, and Golgi apparatus fragmentation. Through phosphorylation, it modulates substrates including transcription factors, cytoskeletal elements, apoptosis regulators, translation regulators, protein kinases, and phosphatases. ERK2 Protein, Human (sf9, His) is the recombinant human-derived ERK2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

The MAPK/ERK cascade plays a crucial role in the regulation of various cellular processes, including transcription, translation, mitosis, apoptosis, endosomal dynamics, and Golgi apparatus fragmentation. It achieves this by phosphorylating a multitude of substrates, including transcription factors, cytoskeletal elements, regulators of apoptosis, regulators of translation, protein kinases, and phosphatases.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

P28482-1 (M1-S360)

Gene ID
Molecular Construction
N-term
ERK2 (M1-S360)
Accession # P28482-1
His
C-term
Synonyms
Mitogen-activated protein kinase 1; MAPK 1; ERT1; ERK-2; p42-MAPK
AA Sequence

MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Molecular Weight

Approximately 42 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Solution

Formulation

Supplied as 0.22 μm filtered solution in 20 mM Tris, 500 mM Nacl, 10% glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

ERK2 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ERK2 Protein, Human (sf9, His)
Cat. No.:
HY-P75223
Quantity:
MCE Japan Authorized Agent: