1. Recombinant Proteins
  2. Receptor Proteins
  3. Erythropoietin receptor/EpoR Protein, Human (HEK293 , Fc)

Erythropoietin receptor/EpoR Protein, Human (HEK293 , Fc)

Cat. No.: HY-P73521
Handling Instructions Technical Support

The EPOR Protein functions as a receptor for erythropoietin, mediating erythroblast proliferation and differentiation upon EPO stimulation. The heterodimer triggers the JAK2/STAT5 signaling cascade and, in certain cell types, activates STAT1, STAT3, and the LYN tyrosine kinase. Additionally, isoform EPOR-T acts as a dominant-negative receptor, modulating EPOR-mediated signaling pathways. Erythropoietin receptor/EpoR Protein, Human (HEK293, Fc) is the recombinant human-derived Erythropoietin receptor/EpoR protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg Get quote
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EPOR Protein functions as a receptor for erythropoietin, mediating erythroblast proliferation and differentiation upon EPO stimulation. The heterodimer triggers the JAK2/STAT5 signaling cascade and, in certain cell types, activates STAT1, STAT3, and the LYN tyrosine kinase. Additionally, isoform EPOR-T acts as a dominant-negative receptor, modulating EPOR-mediated signaling pathways. Erythropoietin receptor/EpoR Protein, Human (HEK293, Fc) is the recombinant human-derived Erythropoietin receptor/EpoR protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The EPOR serves as the receptor for erythropoietin (EPO), playing a crucial role in mediating EPO-induced erythroblast proliferation and differentiation. Upon stimulation by EPO, the EPOR component of the heterodimer undergoes dimerization, initiating the JAK2/STAT5 signaling cascade. In certain cell types, this heterodimeric receptor complex can additionally activate STAT1 and STAT3, and may participate in the activation of the LYN tyrosine kinase. Notably, the isoform EPOR-T acts as a dominant-negative receptor, modulating and attenuating EPOR-mediated signaling pathways. The intricate interplay within the EPORic complex underscores its significance in regulating cellular responses to EPO stimulation.

Species

Human

Source

HEK293

Tag

C-hFc;C-Avi

Accession

P19235-1/NP_000112.1 (A25-P250)

Gene ID
Molecular Construction
N-term
EpoR (A25-P250)
Accession # P19235-1/NP_000112.1
hFc-Avi
C-term
Protein Length

Extracellular Domain

Synonyms
EpoR; EPO-R; Erythropoietin R; Erythropoietin receptor
AA Sequence

APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP

Predicted Molecular Mass
52.6 kDa
Molecular Weight

55-60 kDa

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, 8% sucrose, 0.5% Tween-20, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Erythropoietin receptor/EpoR Protein, Human (HEK293 , Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Erythropoietin receptor/EpoR Protein, Human (HEK293 , Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Erythropoietin receptor/EpoR Protein, Human (HEK293 , Fc)
Cat. No.:
HY-P73521
Quantity:
MCE Japan Authorized Agent: