Erythropoietin receptor/EpoR Protein, Human (Biotinylated, HEK293 , hFc-Avi)

The EPOR Protein functions as a receptor for erythropoietin, mediating erythroblast proliferation and differentiation upon EPO stimulation. The heterodimer triggers the JAK2/STAT5 signaling cascade and, in certain cell types, activates STAT1, STAT3, and the LYN tyrosine kinase. Additionally, isoform EPOR-T acts as a dominant-negative receptor, modulating EPOR-mediated signaling pathways. Erythropoietin receptor/EpoR Protein, Human (Biotinylated, HEK293 , hFc-Avi) is the recombinant human-derived Erythropoietin receptor/EpoR protein, expressed by HEK293 , with C-hFc-Avi labeled tag.

The EPOR serves as the receptor for erythropoietin (EPO), playing a crucial role in mediating EPO-induced erythroblast proliferation and differentiation. Upon stimulation by EPO, the EPOR component of the heterodimer undergoes dimerization, initiating the JAK2/STAT5 signaling cascade. In certain cell types, this heterodimeric receptor complex can additionally activate STAT1 and STAT3, and may participate in the activation of the LYN tyrosine kinase. Notably, the isoform EPOR-T acts as a dominant-negative receptor, modulating and attenuating EPOR-mediated signaling pathways. The intricate interplay within the EPORic complex underscores its significance in regulating cellular responses to EPO stimulation.

Immobilized Human EPO, No Tag at 5 μg/mL (100 μL/well) on the plate. Dose response curve for Biotinylated Human EPO R, hFc Tag with the EC₅₀ of 0.70 μg/mL determined by ELISA.

Human

HEK293

C-hFc;C-Avi

P19235-1/NP_000112.1 (A25-P250)

2057

Extracellular Domain

Biotin

APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP

Approximately 55-70 kDa, based on Bis-Tris PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.