Erythropoietin receptor/EpoR Protein, Human (HEK293, His)

The EPOR Protein functions as a receptor for erythropoietin, mediating erythroblast proliferation and differentiation upon EPO stimulation. The heterodimer triggers the JAK2/STAT5 signaling cascade and, in certain cell types, activates STAT1, STAT3, and the LYN tyrosine kinase. Additionally, isoform EPOR-T acts as a dominant-negative receptor, modulating EPOR-mediated signaling pathways. Erythropoietin receptor/EpoR Protein, Human (HEK293, His) is the recombinant human-derived Erythropoietin receptor/EpoR protein, expressed by HEK293 , with C-6*His labeled tag.

The EPOR serves as the receptor for erythropoietin (EPO), playing a crucial role in mediating EPO-induced erythroblast proliferation and differentiation. Upon stimulation by EPO, the EPOR component of the heterodimer undergoes dimerization, initiating the JAK2/STAT5 signaling cascade. In certain cell types, this heterodimeric receptor complex can additionally activate STAT1 and STAT3, and may participate in the activation of the LYN tyrosine kinase. Notably, the isoform EPOR-T acts as a dominant-negative receptor, modulating and attenuating EPOR-mediated signaling pathways. The intricate interplay within the EPORic complex underscores its significance in regulating cellular responses to EPO stimulation.

Measured by its ability to inhibit Epo-dependent proliferation of TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 79.98 ng/mL, corresponding to a specific activity is 1.2053×10⁴ units/mg.

• 
  Measured by its ability to inhibit Epo-dependent proliferation of TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is 79.98 ng/mL, corresponding to a specific activity is 1.2053×10⁴ units/mg.

Human

HEK293

C-6*His

P19235-1 (A25-P250)

2057  [NCBI]

Extracellular Domain

APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP

approximately 32.54 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 8% trehalose, 2% mannitol, 50 mM NaCl, 0.05% Tween 80, pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.