1. Recombinant Proteins
  2. Receptor Proteins
  3. Erythropoietin receptor/EpoR Protein, Human (226a.a, HEK293, His)

Erythropoietin receptor/EpoR Protein, Human (226a.a, HEK293, His)

Cat. No.: HY-P70314
COA Handling Instructions

For research use only. We do not sell to patients.

Size Price Stock Quantity
Free Sample   Apply now  
2 μg $40 In-stock
Estimated Time of Arrival: December 31
10 μg $110 In-stock
Estimated Time of Arrival: December 31
50 μg $330 In-stock
Estimated Time of Arrival: December 31
100 μg $560 In-stock
Estimated Time of Arrival: December 31
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Biological Activity
  • Measured by its ability to inhibit Epo-dependent proliferation of TF‑1 human erythroleukemic cells. The ED50 for this effect is 79.98 ng/mL, corresponding to a specific activity is 1.2053×104 units/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P19235 (A25-P250)

Gene ID
Synonyms
rHuErythropoietin receptor/EpoR, His; EpoR; EPO-R; Erythropoietin R; erythropoietin receptor; MGC138358
AA Sequence

APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP

Molecular Weight

approximately 32.54 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Erythropoietin receptor/EpoR Protein, Human (226a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Erythropoietin receptor/EpoR Protein, Human (226a.a, HEK293, His)
Cat. No.:
HY-P70314
Quantity:
MCE Japan Authorized Agent: