FABP3 Protein, Mouse

Customer Review

Based on 1 Customer Validation

FABP3 is a member of the fatty acid-binding protein (FABP) family and is thought to facilitate the intracellular transport of long-chain fatty acids and their acyl-CoA esters. As part of this family of proteins, FABP3 may play a crucial role in promoting cellular uptake and transport of fatty acids, supporting various metabolic processes within cells. FABP3 Protein, Mouse is the recombinant mouse-derived FABP3 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

FABP3 is a member of the fatty acid-binding protein (FABP) family and is thought to facilitate the intracellular transport of long-chain fatty acids and their acyl-CoA esters. As part of this family of proteins, FABP3 may play a crucial role in promoting cellular uptake and transport of fatty acids, supporting various metabolic processes within cells. FABP3 Protein, Mouse is the recombinant mouse-derived FABP3 protein, expressed by E. coli , with tag free.

Background

The FABP3 protein, a member of the fatty acid-binding protein (FABP) family, is implicated in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. As a representative of this protein family, FABP3 likely participates in facilitating the movement of fatty acids within cells, contributing to various cellular processes such as lipid metabolism, energy production, and cellular signaling. By binding and transporting long-chain fatty acids, FABP3 plays a crucial role in regulating the availability and utilization of these essential molecules within cells. The functional implications of FABP3's involvement in fatty acid transport underscore its significance in maintaining cellular homeostasis and metabolic balance, making it a key player in lipid-related processes.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • FABP3 (M1-A133)
      Accession # P11404
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    FABP3; Heart-Type Fatty Acid-Binding Protein; Prev. FABP11; Muscle Fatty Acid-Binding Protein; Prev. MDGI; Fatty Acid Binding Protein 11; H-FABP; M-FABP; Mammary-Derived Growth Inhibitor; Fatty Acid Binding Protein 3, Muscle And Heart (Mammary-Derived Gro

  • AA Sequence

    MADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTQSTFKNTEINFQLGIEFDEVTADDRKVKSLVTLDGGKLIHVQKWNGQETTLTRELVDGKLILTLTHGSVVSTRTYEKEA

  • Predicted Molecular Mass

    14.8 kDa

  • Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00