FABP3 Protein, Mouse

FABP3 is a member of the fatty acid-binding protein (FABP) family and is thought to facilitate the intracellular transport of long-chain fatty acids and their acyl-CoA esters. As part of this family of proteins, FABP3 may play a crucial role in promoting cellular uptake and transport of fatty acids, supporting various metabolic processes within cells. FABP3 Protein, Mouse is the recombinant mouse-derived FABP3 protein, expressed by E. coli , with tag free. The total length of FABP3 Protein, Mouse is 133 a.a., with molecular weight of ~14.8 kDa.

The FABP3 protein, a member of the fatty acid-binding protein (FABP) family, is implicated in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. As a representative of this protein family, FABP3 likely participates in facilitating the movement of fatty acids within cells, contributing to various cellular processes such as lipid metabolism, energy production, and cellular signaling. By binding and transporting long-chain fatty acids, FABP3 plays a crucial role in regulating the availability and utilization of these essential molecules within cells. The functional implications of FABP3's involvement in fatty acid transport underscore its significance in maintaining cellular homeostasis and metabolic balance, making it a key player in lipid-related processes.

Mouse

E. coli

Tag Free

P11404 (M1-A133)

14077  [NCBI]

MADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTQSTFKNTEINFQLGIEFDEVTADDRKVKSLVTLDGGKLIHVQKWNGQETTLTRELVDGKLILTLTHGSVVSTRTYEKEA

Approximately 14.8 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.