1. Recombinant Proteins
  2. Fc Receptors
  3. Fc-epsilon Receptor
  4. Fc epsilon RIA
  5. Fc epsilon RIA/FCER1A Protein, Human (His-SUMO)

Fc epsilon RIA/FCER1A Protein, Human (His-SUMO)

Cat. No.: HY-P72191
SDS COA Handling Instructions

The Fc epsilon RIA/FCER1A protein is a high-affinity receptor for IgE and critically mediates IgE effector function in myeloid cells. After binding to IgE and cross-linking with antigen, it activates signaling pathways that induce myeloid cell activation and differentiation. Fc epsilon RIA/FCER1A Protein, Human (His-SUMO) is the recombinant human-derived Fc epsilon RIA/FCER1A protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of Fc epsilon RIA/FCER1A Protein, Human (His-SUMO) is 180 a.a., with molecular weight of ~37 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Fc epsilon RIA/FCER1A protein is a high-affinity receptor for IgE and critically mediates IgE effector function in myeloid cells. After binding to IgE and cross-linking with antigen, it activates signaling pathways that induce myeloid cell activation and differentiation. Fc epsilon RIA/FCER1A Protein, Human (His-SUMO) is the recombinant human-derived Fc epsilon RIA/FCER1A protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of Fc epsilon RIA/FCER1A Protein, Human (His-SUMO) is 180 a.a., with molecular weight of ~37 kDa.

Background

Fc epsilon RIA/FCER1A Protein takes center stage as a high-affinity receptor designed for immunoglobulin epsilon/IgE, serving as a crucial mediator of IgE effector functions in myeloid cells. Upon binding to IgE and subsequent cross-linking with antigens/allergens, it activates signaling pathways that induce myeloid cell activation and differentiation. Particularly on mast cells, basophils, and eosinophils, Fc epsilon RIA triggers the secretion of vasoactive amines, lipid mediators, and cytokines, contributing to inflammatory responses, tissue remodeling, and cytotoxicity against microbes. This orchestrated response forms a part of the immediate hypersensitivity reaction to allergens, acting as a host defense mechanism against helminth parasites, pathogenic bacteria, and venom toxicity. However, when dysregulated, this receptor can lead to harmful and life-threatening allergic and anaphylactic reactions. Structurally, it exists as a tetramer comprising an alpha chain, a beta chain, and two disulfide-linked gamma chains, and it interacts with IGHE via the CH3 region.

Species

Human

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

P12319 (V26-Q205)

Gene ID
Molecular Construction
N-term
6*His-SUMO
FCER1A (V26-Q205)
Accession # P12319
C-term
Synonyms
Fc epsilon RI alpha; Fc epsilon RI alpha chain ; high affinity I; receptor for; alpha subunit; Fc fragment of IgE; high affinity I; receptor for; alpha polypeptide; Fc IgE receptor; alpha chain; Fc IgE receptor; alpha polypeptide; Fc-epsilon RI-alpha; FCE 1A; FCE1A; FCER1A; Fcer1a; FCERA_HUMAN; FceRI alpha; FcERI; high affinity IgE receptor;
AA Sequence

VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ

Molecular Weight

Approximately 37 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Fc epsilon RIA/FCER1A Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fc epsilon RIA/FCER1A Protein, Human (His-SUMO)
Cat. No.:
HY-P72191
Quantity:
MCE Japan Authorized Agent: