Fc epsilon RIA/FCER1A Protein, Human (His-SUMO)

The Fc epsilon RIA/FCER1A protein is a high-affinity receptor for IgE and critically mediates IgE effector function in myeloid cells. After binding to IgE and cross-linking with antigen, it activates signaling pathways that induce myeloid cell activation and differentiation. Fc epsilon RIA/FCER1A Protein, Human (His-SUMO) is the recombinant human-derived Fc epsilon RIA/FCER1A protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Fc epsilon RIA/FCER1A Protein takes center stage as a high-affinity receptor designed for immunoglobulin epsilon/IgE, serving as a crucial mediator of IgE effector functions in myeloid cells. Upon binding to IgE and subsequent cross-linking with antigens/allergens, it activates signaling pathways that induce myeloid cell activation and differentiation. Particularly on mast cells, basophils, and eosinophils, Fc epsilon RIA triggers the secretion of vasoactive amines, lipid mediators, and cytokines, contributing to inflammatory responses, tissue remodeling, and cytotoxicity against microbes. This orchestrated response forms a part of the immediate hypersensitivity reaction to allergens, acting as a host defense mechanism against helminth parasites, pathogenic bacteria, and venom toxicity. However, when dysregulated, this receptor can lead to harmful and life-threatening allergic and anaphylactic reactions. Structurally, it exists as a tetramer comprising an alpha chain, a beta chain, and two disulfide-linked gamma chains, and it interacts with IGHE via the CH3 region.

Measured by its binding ability in a functional ELISA.When Recombinant Human Fc epsilon RIA/FCER1A is immobilized at 0.1 μg/mL can bind Biotinylated Human IgE. The ED₅₀ for this effect is 5.864 μg/mL.

• 
  Measured by its binding ability in a functional ELISA.When Recombinant Human Fc epsilon RIA/FCER1A is immobilized at 0.1 μg/mL can bind Biotinylated Human IgE. The ED₅₀ for this effect is 5.864 μg/mL.

Human

E. coli

N-6*His;N-SUMO

P12319 (V26-Q205)

2205  [NCBI]

Extracellular Domain

VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ

Approximately 37 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/hec-1-cell.html