Copy Link Print Information

FGF-1 Protein, Human

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

FGF-1 Protein, Human is a growth factor and signaling protein encoded by the FGF1 gene.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FGF-1 Protein, Human
  • Experimental Validation Results for FGF-1 Protein, Human
  • Experimental Validation Results for FGF-1 Protein, Human
  • Experimental Validation Results for FGF-1 Protein, Human
  • Experimental Validation Results for FGF-1 Protein, Human
  • Experimental Validation Results for FGF-1 Protein, Human
  • Experimental Validation Results for FGF-1 Protein, Human
  • Experimental Validation Results for FGF-1 Protein, Human
  • FGF-1 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF-1 Protein, Human is a growth factor and signaling protein encoded by the FGF1 gene.

Background

Acidic Fibroblast Growth Factor is involved in a wide spectrum of biological functions including tissue development and repair, angiogenesis, proliferation of both epithelial and mesenchymal cells, and tumorigenesis. The biological activities of Acidic Fibroblast Growth Factor depend on binding to highly specific cell surface receptors, among which, fibroblast growth factor receptor 4 (FGFR4) is highly specific[1].

Verified Bioactivity

The ED50 is <0.3 ng/mL, measured by a cell proliferation assay of 3T3 Cells, corresponding to a specific activity of > 3.3 × 106 IU/mg in the presence of 10.0 μg/ml of heparin.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P05230-1 (F16-D155)

  • Gene ID
    2246  [NCBI]
  • Molecular Construction
    • N-term
    • FGF-1 (F16-D155)
      Accession # P05230-1
    • C-term
  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Synonyms

    FGF1; Endothelial Cell Growth Factor, Alpha; Prev. FGFA; Fibroblast Growth Factor 1 (Acidic); Heparin-Binding Growth Factor 1; Acidic Fibroblast Growth Factor; AFGF; HBGF-1; ECGF; FGF-1; ECGF-Beta; Beta-Endothelial Cell Growth Factor; FGF-Alpha; Endotheli

  • AA Sequence

    FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

  • Predicted Molecular Mass

    16 kDa

  • Molecular Weight

    Approximately 16-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 6.8.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.8, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. La Rosa S, et al. Expression of acidic fibroblast growth factor (aFGF) and fibroblast growth factor receptor 4 (FGFR4) in breast fibroadenomas. J Clin Pathol. 2001 Jan;54(1):37-41. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     The ED50 is 0.01025 ng/mL, measured by a cell proliferation assay of 3T3 Cells, corresponding to a specific activity of 9.76×107 IU/mg in the presence of 10.0 μg/mL of heparin.

  • 1/16

    FGF-1 Protein, Human purchased from MedChemExpress. Usage Cited in: Cell Death Discov. 2025 Dec 22;11(1):562. [Abstract]

    Customer Validation
     Transfection of FGF1 siRNAs or control into wild-type or RORγ-overexpressing RBE and HUCCT-1 cells, with or without 5 ng/mL human recombinant FGF1 (FGF-1 Protein, Human). Viable cells were counted after 4 days. The results showed that FGF-1 Protein, Human rescued the inhibitory effects of FGF1 silencing.

  • 1/16

    FGF-1 Protein, Human purchased from MedChemExpress. Usage Cited in: Cell Death Discov. 2025 Dec 22;11(1):562. [Abstract]

    Customer Validation
     FGFR2, phosphorylated FGFR2 (p-FGFR2), and its downstream proteins were detected by immunoblotting in RBE and HUCCT-1 cells treated with recombinant human FGF1 (FGF-1 Protein, Human) at the specified concentrations for 20 min. The results showed that FGF-1 Protein, Human (rhFGF1) treatment induced FGFR2 phosphorylation and downstream ERK activation in a dose-dependent manner In both RBE and HUCCT-1 cells.

  • 1/16

    FGF-1 Protein, Human purchased from MedChemExpress. Usage Cited in: Apoptosis. 2025 Feb;30(1-2):16-34. [Abstract]

    Customer Validation
     Cells stably expressing the vector and PRELP were treated with the recombinant FGF-1 Protein, Human (10 ng/mL) for 48 h and analyzed using a CCK-8 assay. The results revealed that FGF-1 Protein, Human partially rescued the inhibition of proliferation caused by PRELP.

  • 1/16

    FGF-1 Protein, Human purchased from MedChemExpress. Usage Cited in: Apoptosis. 2025 Feb;30(1-2):16-34. [Abstract]

    Customer Validation
     Cells stably expressing the vector and PRELP were treated with the recombinant FGF-1 Protein, Human (10 ng/mL) for 48 h and analyzed using a tube formation assay. The results showed that HUVECs were more likely to vascularize in the presence of FGF-1 Protein, Human.

  • 1/16

    FGF-1 Protein, Human purchased from MedChemExpress. Usage Cited in: Apoptosis. 2025 Feb;30(1-2):16-34. [Abstract]

    Customer Validation
     Cells stably expressing the vector and PRELP were treated with the recombinant FGF-1 Protein, Human (10 ng/mL) for 48 h and analyzed using a Transwell assay. The results confirmed that the migration and invasion abilities of SW620 and RKO cells were restored by the recombinant FGF-1 Protein, Human.

  • 1/16

    FGF-1 Protein, Human purchased from MedChemExpress. Usage Cited in: Apoptosis. 2025 Feb;30(1-2):16-34. [Abstract]

    Customer Validation
     Cells stably expressing the vector and PRELP were treated with the recombinant FGF-1 Protein, Human (10 ng/mL) for 48 h and analyzed using a Western blot. The results indicated that FGF-1 Protein, Human could reactivate the PI3K/AKT/mTOR signaling pathway and promote the expression of VEGFA and EMT-related markers.

  • FGF-1 Protein, Human Product Image
    1/16
  • Experimental Validation Results for FGF-1 Protein, Human
  • Experimental Validation Results for FGF-1 Protein, Human
  • Experimental Validation Results for FGF-1 Protein, Human
  • Experimental Validation Results for FGF-1 Protein, Human
  • Experimental Validation Results for FGF-1 Protein, Human
  • Experimental Validation Results for FGF-1 Protein, Human
  • Experimental Validation Results for FGF-1 Protein, Human
  • Experimental Validation Results for FGF-1 Protein, Human
  • FGF-1 Protein, Human Product Image

  • FGF-1 Protein, Human purchased from MedChemExpress. Usage Cited in: Cell Death Discov. 2025 Dec 22;11(1):562. [Abstract]

    Transfection of FGF1 siRNAs or control into wild-type or RORγ-overexpressing RBE and HUCCT-1 cells, with or without 5 ng/mL human recombinant FGF1 (FGF-1 Protein, Human). Viable cells were counted after 4 days. The results showed that FGF-1 Protein, Human rescued the inhibitory effects of FGF1 silencing.

  • FGF-1 Protein, Human purchased from MedChemExpress. Usage Cited in: Cell Death Discov. 2025 Dec 22;11(1):562. [Abstract]

    FGFR2, phosphorylated FGFR2 (p-FGFR2), and its downstream proteins were detected by immunoblotting in RBE and HUCCT-1 cells treated with recombinant human FGF1 (FGF-1 Protein, Human) at the specified concentrations for 20 min. The results showed that FGF-1 Protein, Human (rhFGF1) treatment induced FGFR2 phosphorylation and downstream ERK activation in a dose-dependent manner In both RBE and HUCCT-1 cells.

  • FGF-1 Protein, Human purchased from MedChemExpress. Usage Cited in: Apoptosis. 2025 Feb;30(1-2):16-34. [Abstract]

    Cells stably expressing the vector and PRELP were treated with the recombinant FGF-1 Protein, Human (10 ng/mL) for 48 h and analyzed using a CCK-8 assay. The results revealed that FGF-1 Protein, Human partially rescued the inhibition of proliferation caused by PRELP.

  • FGF-1 Protein, Human purchased from MedChemExpress. Usage Cited in: Apoptosis. 2025 Feb;30(1-2):16-34. [Abstract]

    Cells stably expressing the vector and PRELP were treated with the recombinant FGF-1 Protein, Human (10 ng/mL) for 48 h and analyzed using a tube formation assay. The results showed that HUVECs were more likely to vascularize in the presence of FGF-1 Protein, Human.

  • FGF-1 Protein, Human purchased from MedChemExpress. Usage Cited in: Apoptosis. 2025 Feb;30(1-2):16-34. [Abstract]

    Cells stably expressing the vector and PRELP were treated with the recombinant FGF-1 Protein, Human (10 ng/mL) for 48 h and analyzed using a Transwell assay. The results confirmed that the migration and invasion abilities of SW620 and RKO cells were restored by the recombinant FGF-1 Protein, Human.

  • FGF-1 Protein, Human purchased from MedChemExpress. Usage Cited in: Apoptosis. 2025 Feb;30(1-2):16-34. [Abstract]

    Cells stably expressing the vector and PRELP were treated with the recombinant FGF-1 Protein, Human (10 ng/mL) for 48 h and analyzed using a Western blot. The results indicated that FGF-1 Protein, Human could reactivate the PI3K/AKT/mTOR signaling pathway and promote the expression of VEGFA and EMT-related markers.