FGF-1 Protein, Human

FGF-1 Protein, Human is a growth factor and signaling protein encoded by the FGF1 gene.

Acidic Fibroblast Growth Factor is involved in a wide spectrum of biological functions including tissue development and repair, angiogenesis, proliferation of both epithelial and mesenchymal cells, and tumorigenesis. The biological activities of Acidic Fibroblast Growth Factor depend on binding to highly specific cell surface receptors, among which, fibroblast growth factor receptor 4 (FGFR4) is highly specific^[1].

The ED₅₀ is <0.3 ng/mL, measured by a cell proliferation assay of 3T3 Cells, corresponding to a specific activity of > 3.3 × 10⁶ IU/mg in the presence of 10.0 μg/ml of heparin.

• 
  The ED₅₀ is 0.01025 ng/mL, measured by a cell proliferation assay of 3T3 Cells, corresponding to a specific activity of 9.76×10⁷ IU/mg in the presence of 10.0 μg/mL of heparin.

Human

E. coli

Tag Free

P05230-1 (F16-D155)

2246  [NCBI]

Full Length of Isoform-1 Mature Protein

FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 6.8.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.8, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. La Rosa S, et al. Expression of acidic fibroblast growth factor (aFGF) and fibroblast growth factor receptor 4 (FGFR4) in breast fibroadenomas. J Clin Pathol. 2001 Jan;54(1):37-41.  [Content Brief]