1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-1
  6. FGF-1 Protein, Human

FGF-1 Protein, Human

Cat. No.: HY-P7001
COA Handling Instructions

FGF-1 Protein, Human is a growth factor and signaling protein encoded by the FGF1 gene.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg $35 In-stock
10 μg $90 In-stock
50 μg $190 In-stock
100 μg $290 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

FGF-1 Protein, Human is a growth factor and signaling protein encoded by the FGF1 gene.

Background

Acidic Fibroblast Growth Factor is involved in a wide spectrum of biological functions including tissue development and repair, angiogenesis, proliferation of both epithelial and mesenchymal cells, and tumorigenesis. The biological activities of Acidic Fibroblast Growth Factor depend on binding to highly specific cell surface receptors, among which, fibroblast growth factor receptor 4 (FGFR4) is highly specific[1].

Biological Activity

The ED50 is <0.3 ng/mL, measured by a cell proliferation assay of 3T3 Cells, corresponding to a specific activity of > 3.3 × 106 IU/mg in the presence of 10.0 μg/ml of heparin.

  • The ED50 is 0.01025 ng/mL, measured by a cell proliferation assay of 3T3 Cells, corresponding to a specific activity of 9.76×107 IU/mg in the presence of 10.0 μg/ml of heparin.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P05230 (F16-D155)

Gene ID
Molecular Construction
N-term
FGF-1 (F16-D155)
Accession # P05230
C-term
Synonyms
rHuaFGF; HBGF-1; ECGF; FGF1; FGF-a; FGF-acidic
AA Sequence

FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Molecular Weight

15-18 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 6.8.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

FGF-1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-1 Protein, Human
Cat. No.:
HY-P7001
Quantity:
MCE Japan Authorized Agent: