FGF-1 Protein, Mouse (N-His)

The FGF-1 protein plays a key role in regulating a variety of cellular processes, serving as a potent mitogen and ligand for FGFR1 and integrins. In the presence of heparin, FGF-1 binds to FGFR1, initiating dimerization and autophosphorylation, resulting in multiple signaling cascades. FGF-1 Protein, Mouse (N-His) is the recombinant mouse-derived FGF-1 protein, expressed by E. coli , with N-6*His labeled tag.

The FGF-1 protein plays a crucial role in the regulation of various cellular processes, including cell survival, division, angiogenesis, differentiation, and migration. It acts as a potent mitogen and functions as a ligand for both FGFR1 and integrins. In the presence of heparin, FGF-1 binds to FGFR1, leading to dimerization and activation through autophosphorylation on tyrosine residues, which serve as docking sites for interacting proteins. This activation triggers multiple signaling cascades. FGF-1 also binds to integrin ITGAV:ITGB3, forming a ternary complex with FGFR1 and inducing the recruitment of PTPN11 to the complex, which is essential for FGF-1 signaling. It induces the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2, and AKT1, and can also stimulate angiogenesis. FGF-1 interacts with several receptors and proteins, including FGFR2, FGFR3, FGFR4, FGFBP1, S100A13, SYT1, LRRC59, CSNKA, CSNKB, and FIBP. Additionally, it forms a Cu(2+)-dependent multiprotein aggregate with S100A13 and SYT1. While the interaction of FGF-1 with LRRC59, CSNKA, and FIBP appears to be mutually exclusive, CSNKB and FIBP may cooperatively interact with FGF-1. Overall, FGF-1 plays a complex role in cellular processes through its interactions with various receptors and proteins.

Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells.The ED₅₀ for this effect is ≤0.4015 ng/mL, corresponding to a specific activity is ≥2.490×10⁶ units/mg.

• 
  Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells.The ED₅₀ for this effect is 0.4015 ng/mL, corresponding to a specific activity is 2.490×10⁶ units/mg.

Mouse

E. coli

N-6*His

P61148 (F16-D155)

14164  [NCBI]

Full Length of Mature Protein

FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 6.5 or 50 mM Tris-HCl, 300 mM NaCl, pH 6.5, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.