Copy Link Print Information

FGF-21 Protein, Human (His)

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

FGF-21 Proteinas influences glucose uptake in adipocytes by inducing SLC2A1/GLUT1 expression, particularly with KLB's presence. It plays a crucial role in systemic glucose homeostasis and insulin sensitivity, interacting directly with KLB through its C-terminus and engaging with FGFR4. The protein's molecular mechanisms involve a complex interplay, emphasizing its broad impact beyond localized effects. FGF-21 Protein, Human (His) is the recombinant human-derived FGF-21 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • FGF-21 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF-21 Proteinas influences glucose uptake in adipocytes by inducing SLC2A1/GLUT1 expression, particularly with KLB's presence. It plays a crucial role in systemic glucose homeostasis and insulin sensitivity, interacting directly with KLB through its C-terminus and engaging with FGFR4. The protein's molecular mechanisms involve a complex interplay, emphasizing its broad impact beyond localized effects. FGF-21 Protein, Human (His) is the recombinant human-derived FGF-21 protein, expressed by E. coli , with N-6*His labeled tag.

Background

FGF-21 protein exerts its biological influence by promoting glucose uptake in differentiated adipocytes, primarily through inducing the expression of the glucose transporter SLC2A1/GLUT1, rather than SLC2A4/GLUT4. This activity is likely contingent on the presence of KLB. Beyond its localized effects, FGF-21 plays a crucial role in the regulation of systemic glucose homeostasis and insulin sensitivity. The protein interacts directly with KLB, facilitated by its C-terminus, and also engages with FGFR4, indicating a complex interplay in its molecular mechanisms.

Verified Bioactivity

Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is ≤1.756 μg/mL in the presence of 1.25 μg/mL recombinant human Klotho beta. Corresponding to a specific activity is ≥569.4761 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    AAH18404.1 (H29-S209)

  • Gene ID
    26291  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • FGF-21 (H29-S209)
      Accession # AAH18404.1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    FGF21; FGF-21; Fibroblast Growth Factor 21; FGF; Fibroblast Growth Factor

  • AA Sequence

    HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

  • Predicted Molecular Mass

    19.4 kDa

  • Molecular Weight

    Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 2 mM EDTA, pH 9.0.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 1.756 μg/mLin the presence of 1.25 μg/mL recombinant human Klotho beta. Corresponding to a specific activity is 569.4761 units/mg.

  • 1/16

    FGF-21 Protein, Human (His) purchased from MedChemExpress. Usage Cited in: J Adv Res. 2025 Oct 29:S2090-1232(25)00848-3. [Abstract]

    Customer Validation
     FGF-21 Protein, Human (His) (FGF21, 24 h). PINK1 protein level in lysates of cytosolic and mitochondrial fractions.

  • 1/16

    FGF-21 Protein, Human (His) purchased from MedChemExpress. Usage Cited in: J Adv Res. 2025 Oct 29:S2090-1232(25)00848-3. [Abstract]

    Customer Validation
     si-NC and si-PINK1 NRCMs were infected with adenovirus encoding LC3 for 24 h, then subjected to 100 μM PE stimulation for 24 h, followed by vehicle or FGF-21 Protein, Human (His) (FGF21, 24 h). These cells were stained using MitoTracker Red dye, scale bar = 20 μm.

  • 1/16

    FGF-21 Protein, Human (His) purchased from MedChemExpress. Usage Cited in: J Adv Res. 2025 Oct 29:S2090-1232(25)00848-3. [Abstract]

    Customer Validation
     Relative ANP mRNA level. The results showed that PINK1 knockdown significantly inhibited the FGF21 (FGF-21 Protein, Human (His), 24 h)-mediated decrease in ANP and BNP expression in PE-treated cells.

  • 1/16

    FGF-21 Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Biomater Res. 2025 Dec 23.

    Customer Validation
     qRT-PCR of M1-and M2-related gene expressions in RAW264.7 cells. The results showed that RAW264.7 cells treated with 100 ng/μL FGF-21 (FGF-21 Protein, Human (His) exhibited the most significant upregulation of M2-type genes and downregulation of M1-type genes.

  • 1/16

    FGF-21 Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Biomater Res. 2025 Dec 23.

    Customer Validation
     FGF-21 Protein, Human (His) (FGF-21, 5-100 ng/μL). Immunofluorescence staining of M1- and M2-related proteins in RAW264.7 cells.

  • 1/16

    FGF-21 Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Biomater Res. 2025 Dec 23.

    Customer Validation
     FGF-21 Protein, Human (His) (FGF-21, 5-100 ng/μL). Western blotting of M1-and M2-related protein expressions in RAW264.7 cells.

  • 1/16

    FGF-21 Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Biomater Res. 2025 Dec 23.

    Customer Validation
     Quantitative analysis of scratch assay in L929 cells stimulated with various concentrations of FGF-21 Protein, Human (His) (FGF-21, 5-100 ng/μL; 24-48 h).

  • 1/16

    FGF-21 Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Biomater Res. 2025 Dec 23.

    Customer Validation
     In vivo evaluation of FGF-21-loaded hydrogel in a full-thickness wound-healing model. Quantified wound closure rates over the 15-d observation period. G/C-CS@FGF-21 (topical application of hydrogel dressing to wound beds): Prepared by mixing FGF-21 (FGF-21 Protein, Human (His), 100 ng/mL) with the G/C-CS mixture.

  • 1/16

    FGF-21 Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Biomater Res. 2025 Dec 23.

    Customer Validation
     In vivo evaluation of FGF-21-loaded hydrogel in a full-thickness wound-healing model. Histological analysis via hematoxylin and eosin (H&E) staining on days 12 and 15. G/C-CS@FGF-21 (topical application of hydrogel dressing to wound beds): Prepared by mixing FGF-21 (FGF-21 Protein, Human (His), 100 ng/mL) with the G/C-CS mixture.

  • FGF-21 Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • Experimental Validation Results for FGF-21 Protein, Human (His)
  • FGF-21 Protein, Human (His) Product Image

  • FGF-21 Protein, Human (His) purchased from MedChemExpress. Usage Cited in: J Adv Res. 2025 Oct 29:S2090-1232(25)00848-3. [Abstract]

    FGF-21 Protein, Human (His) (FGF21, 24 h). PINK1 protein level in lysates of cytosolic and mitochondrial fractions.

  • FGF-21 Protein, Human (His) purchased from MedChemExpress. Usage Cited in: J Adv Res. 2025 Oct 29:S2090-1232(25)00848-3. [Abstract]

    si-NC and si-PINK1 NRCMs were infected with adenovirus encoding LC3 for 24 h, then subjected to 100 μM PE stimulation for 24 h, followed by vehicle or FGF-21 Protein, Human (His) (FGF21, 24 h). These cells were stained using MitoTracker Red dye, scale bar = 20 μm.

  • FGF-21 Protein, Human (His) purchased from MedChemExpress. Usage Cited in: J Adv Res. 2025 Oct 29:S2090-1232(25)00848-3. [Abstract]

    Relative ANP mRNA level. The results showed that PINK1 knockdown significantly inhibited the FGF21 (FGF-21 Protein, Human (His), 24 h)-mediated decrease in ANP and BNP expression in PE-treated cells.

  • FGF-21 Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Biomater Res. 2025 Dec 23.

    qRT-PCR of M1-and M2-related gene expressions in RAW264.7 cells. The results showed that RAW264.7 cells treated with 100 ng/μL FGF-21 (FGF-21 Protein, Human (His) exhibited the most significant upregulation of M2-type genes and downregulation of M1-type genes.

  • FGF-21 Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Biomater Res. 2025 Dec 23.

    FGF-21 Protein, Human (His) (FGF-21, 5-100 ng/μL). Immunofluorescence staining of M1- and M2-related proteins in RAW264.7 cells.

  • FGF-21 Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Biomater Res. 2025 Dec 23.

    FGF-21 Protein, Human (His) (FGF-21, 5-100 ng/μL). Western blotting of M1-and M2-related protein expressions in RAW264.7 cells.

  • FGF-21 Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Biomater Res. 2025 Dec 23.

    Quantitative analysis of scratch assay in L929 cells stimulated with various concentrations of FGF-21 Protein, Human (His) (FGF-21, 5-100 ng/μL; 24-48 h).

  • FGF-21 Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Biomater Res. 2025 Dec 23.

    In vivo evaluation of FGF-21-loaded hydrogel in a full-thickness wound-healing model. Quantified wound closure rates over the 15-d observation period. G/C-CS@FGF-21 (topical application of hydrogel dressing to wound beds): Prepared by mixing FGF-21 (FGF-21 Protein, Human (His), 100 ng/mL) with the G/C-CS mixture.

  • FGF-21 Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Biomater Res. 2025 Dec 23.

    In vivo evaluation of FGF-21-loaded hydrogel in a full-thickness wound-healing model. Histological analysis via hematoxylin and eosin (H&E) staining on days 12 and 15. G/C-CS@FGF-21 (topical application of hydrogel dressing to wound beds): Prepared by mixing FGF-21 (FGF-21 Protein, Human (His), 100 ng/mL) with the G/C-CS mixture.