FGF-4 Protein, Mouse
Based on 1 Customer Validation
The FGF-4 protein plays a key role in embryonic development and is central to cell proliferation and differentiation. It is essential for the survival of mouse embryos after implantation and is key to normal limb and heart valve development. FGF-4 Protein, Mouse is the recombinant mouse-derived FGF-4 protein, expressed by E. coli , with tag free.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
The FGF-4 protein plays a key role in embryonic development and is central to cell proliferation and differentiation. It is essential for the survival of mouse embryos after implantation and is key to normal limb and heart valve development. FGF-4 Protein, Mouse is the recombinant mouse-derived FGF-4 protein, expressed by E. coli , with tag free.
FGF-4 Protein assumes a pivotal role in shaping embryonic development, acting as a central regulator of cell proliferation and differentiation. Its indispensability is underscored by its essential role in ensuring the survival of postimplantation mouse embryos. During embryogenesis, FGF-4 is a key player in orchestrating normal limb and cardiac valve development, reflecting its diverse impact on tissue morphogenesis. Additionally, FGF-4 may contribute to the intricate process of embryonic molar tooth bud development by inducing the expression of MSX1, MSX2, and SDC1 in dental mesenchyme cells. This versatile protein engages in interactions with FGFR1, FGFR2, FGFR3, and FGFR4, forming molecular partnerships that underpin its multifaceted functions. The cooperative binding with heparan sulfate glycosaminoglycans enhances the affinity between FGF-4 and its receptors, adding a layer of complexity to its regulatory mechanisms.
Measured in a cell proliferation assay using NIH-3T3 cells. The ED50 for this effect is 0.5105-0.7284 ng/mL.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
P11403 (S67-L202)
-
Molecular Construction
-
N-term
-
FGF-4 (S67-L202)
Accession # P11403 -
C-term
-
-
Protein Length
Partial
-
Synonyms
FGF4; Heparin-Binding Growth Factor 4; Prev. HSTF1; HSTF-1; HBGF-4; FGF-4; HST-1; Heparin Secretory-Transforming Protein 1; HST; Fibroblast Growth Factor; Transforming Protein KS3; Oncogene HST; K-FGF; SRTD22; KFGF; KS3; Human Stomach Cancer, Transforming
-
AA Sequence
SGAGDYLLGLKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTRDSLLELSPVQRGVVSIFGVASRFFVAMSSRGKLFGVPFFTDECKFKEILLPNNYNAYESYAYPGMFMALSKNGRTKKGNRVSPTMKVTHFLPRL
-
Predicted Molecular Mass
15.2 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)