FGF-4 Protein, Mouse

The FGF-4 protein plays a key role in embryonic development and is central to cell proliferation and differentiation. It is essential for the survival of mouse embryos after implantation and is key to normal limb and heart valve development. FGF-4 Protein, Mouse is the recombinant mouse-derived FGF-4 protein, expressed by E. coli , with tag free. The total length of FGF-4 Protein, Mouse is 136 a.a., with molecular weight of ~15 kDa.

FGF-4 Protein assumes a pivotal role in shaping embryonic development, acting as a central regulator of cell proliferation and differentiation. Its indispensability is underscored by its essential role in ensuring the survival of postimplantation mouse embryos. During embryogenesis, FGF-4 is a key player in orchestrating normal limb and cardiac valve development, reflecting its diverse impact on tissue morphogenesis. Additionally, FGF-4 may contribute to the intricate process of embryonic molar tooth bud development by inducing the expression of MSX1, MSX2, and SDC1 in dental mesenchyme cells. This versatile protein engages in interactions with FGFR1, FGFR2, FGFR3, and FGFR4, forming molecular partnerships that underpin its multifaceted functions. The cooperative binding with heparan sulfate glycosaminoglycans enhances the affinity between FGF-4 and its receptors, adding a layer of complexity to its regulatory mechanisms.

Measured in a cell proliferation assay using NIH-3T3 cells. The ED₅₀ for this effect is 0.7284 ng/mL, corresponding to a specific activity is 1.37×10⁶ units/mg.

Mouse

E. coli

Tag Free

P11403 (S67­L202)

14175  [NCBI]

SGAGDYLLGLKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTRDSLLELSPVQRGVVSIFGVASRFFVAMSSRGKLFGVPFFTDECKFKEILLPNNYNAYESYAYPGMFMALSKNGRTKKGNRVSPTMKVTHFLPRL

Approximately 15 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.