FGF-8b Protein, Human/Mouse

FGF-8b Protein, Human/Mouse is the recombinant mouse, human-derived FGF-8b protein, expressed by E. coli, with tag free.

FGF-8b plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation, and cell migration. It is required for normal brain, eye, ear, and limb development during embryogenesis. Additionally, FGF-8b is essential for the normal development of the gonadotropin-releasing hormone (GnRH) neuronal system (by similar: PubMed:16384934, PubMed:16597617, PubMed:8663044). It also functions in neurite outgrowth in hippocampal cells (by similar: PubMed:21576111).

1.Measured in a cell proliferation assay using BALB/c 3T3 cells and the special bioactivity is <40.58 ng/mL.
2.Measured in a cell proliferation assay using NIH/3T3 mouse fibroblast cells. The ED₅₀ for this effect is typically 10-60 ng/mL in the presence of 1 µg/mL heparin.

• 
  Measured in a cell proliferation assay using NIH/3T3 mouse fibroblast cells. The ED₅₀ for this effect is typically 51.21 ng/mL in the presence of 1 µg/mL heparin, corresponding to a specific activity is 1.95×10^4 U/mg.

Human; Mouse

E. coli

Tag Free

P55075-3/P37237-2 (Q23-R215)

2253  [NCBI]/14179  [NCBI]

Partial

QVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Approximately 22-28 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 300 mM NaCl, 2% sucrose, 0.02% Tween 80, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/hek293-cell.html  [Content Brief]