FGL1 Protein, Human (Biotinylated, 242a.a, HEK293, His-Avi)

FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (Biotinylated, 242a.a, HEK293, His-Avi) is the recombinant human-derived FGL1 protein, expressed by HEK293 , with N-Avi, N-His labeled tag.

FGL1 protein functions as an immune suppressive molecule, exerting inhibitory effects on antigen-specific T-cell activation by serving as a major ligand for LAG3. It plays a pivotal role in mediating LAG3's T-cell inhibitory function independently of MHC class II (MHC-II) binding. Beyond its immune-regulatory role, FGL1 is secreted by hepatocytes, contributing to their growth. Existing as a homodimer, FGL1 interacts with LAG3 through its Fibrinogen C-terminal domain, specifically binding to LAG3's Ig-like domains 1 and 2. This molecular interaction, detailed in studies, underscores the significance of FGL1 in modulating immune responses and hepatocyte growth, highlighting its potential as a key player in the regulation of T-cell activation and hepatic functions.

Immobilized Biotinylated Human FGL1, His-Avi Tag at 5 μg/mL (100 μL/Well) on streptavidin (5 μg/mL) precoated plate. Dose response curve for Human LAG3, hFc Tag with the EC₅₀ of 0.15 μg/mL determined by ELISA.

Human

HEK293

N-Avi;N-6*His

Q08830 (D64-N305)

2267  [NCBI]

Partial

Biotin

DKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPN

Approximately 31.9 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.