1. Recombinant Proteins
  2. Immune Checkpoint Proteins CAR-T Related Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. B7-H3 B7-H3/CD276
  5. FITC-Labeled CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (HEK293, His)

FITC-Labeled CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (HEK293, His)

Cat. No.: HY-P704456
Instrucciones de manejo Technical Support

CD276/B7-H3 protein can regulate T cell-mediated immune responses and act as a protective factor for tumor cells by inhibiting natural killer-mediated cell lysis. It also functions as a neuroblastoma cell marker, plays a role in acute and chronic transplant rejection, and modulates lymphocyte activity at mucosal surfaces. FITC-Labeled CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (HEK293, His) is the recombinant human-derived FITC-Labeled CD276/B7-H3 protein, expressed by HEK293, with C-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
25 μg Obtener un presupuesto 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg Obtener un presupuesto 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   Obtener un presupuesto  
Synthetic products have potential research and development risk.

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

CD276/B7-H3 protein can regulate T cell-mediated immune responses and act as a protective factor for tumor cells by inhibiting natural killer-mediated cell lysis. It also functions as a neuroblastoma cell marker, plays a role in acute and chronic transplant rejection, and modulates lymphocyte activity at mucosal surfaces. FITC-Labeled CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (HEK293, His) is the recombinant human-derived FITC-Labeled CD276/B7-H3 protein, expressed by HEK293, with C-His labeled tag.

Background

The CD276/B7-H3 protein is suggested to play a multifaceted role in the regulation of T-cell-mediated immune responses, potentially acting as a protective factor in tumor cells by inhibiting natural-killer-mediated cell lysis and serving as a marker for the detection of neuroblastoma cells. Additionally, CD276/B7-H3 may be involved in the development of acute and chronic transplant rejection, contributing to the regulation of lymphocytic activity at mucosal surfaces. Notably, it could play a crucial role in providing the placenta and fetus with an immunologically suitable environment throughout pregnancy. Both isoform 1 and isoform 2 of CD276/B7-H3 appear redundant in their ability to modulate CD4 T-cell responses, with isoform 2 demonstrated to enhance the induction of cytotoxic T-cells and selectively stimulate interferon-gamma production in the presence of T-cell receptor signaling. The interaction with TREML2 is identified as enhancing T-cell activation, highlighting the diverse roles CD276/B7-H3 may play in immune regulation and cellular responses.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q5ZPR3-1 (L29-T461)

Gene ID

80381

Molecular Construction
N-term
CD276 (L29-T461)
Accession # Q5ZPR3-1
His
C-term
Protein Length

Partial

Synonyms
CD276; CD276 molecule; CD276 antigen; B7 H3; B7H3; B7RP 2; B7 homolog 3; costimulatory molecule; B7-H3; B7RP-2; 4Ig-B7-H3;
AA Sequence

LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMT

Predicted Molecular Mass
48.5 kDa
Peso molecular

Approximately 60-70 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 1 year from date of receipt, protect from light. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

FITC-Labeled CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (HEK293, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
FITC-Labeled CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (HEK293, His)
Cat. No.:
HY-P704456
Cantidad:
MCE Japan Authorized Agent: