1. Recombinant Proteins
  2. Cytokines and Growth Factors CAR-T Related Proteins Receptor Proteins Enzymes & Regulators Fluorescent-labeled Recombinant Proteins Kinases
  3. EGF Superfamily ErbB3/HER3 Receptor Tyrosine Kinases Cytokine Receptors Protein Tyrosine Kinases Pseudokinases TK
  4. EGFR/ErbB family
  5. FITC-labeled HER3 Protein, Human (HEK293, His-Avi)

FITC-labeled HER3 Protein, Human (HEK293, His-Avi)

Cat. No.: HY-P701281
Handling Instructions Technical Support

HER3, a pivotal tyrosine-protein kinase, acts as a crucial cell receptor for neuregulins. Neuregulin-1 (NRG1) activation boosts tyrosine phosphorylation and interaction with p85 subunit of phosphatidylinositol 3-kinase. CSPG5 may also activate HER3. Its involvement in myeloid cell differentiation underscores HER3's vital role in essential cellular processes for normal development and function. FITC-labeled HER3 Protein, Human (HEK293, His) is the recombinant human-derived FITC-labeled HER3 protein, expressed by HEK293 , with C-His, C-Avi labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HER3, a pivotal tyrosine-protein kinase, acts as a crucial cell receptor for neuregulins. Neuregulin-1 (NRG1) activation boosts tyrosine phosphorylation and interaction with p85 subunit of phosphatidylinositol 3-kinase. CSPG5 may also activate HER3. Its involvement in myeloid cell differentiation underscores HER3's vital role in essential cellular processes for normal development and function. FITC-labeled HER3 Protein, Human (HEK293, His) is the recombinant human-derived FITC-labeled HER3 protein, expressed by HEK293 , with C-His, C-Avi labeled tag.

Background

HER3, a tyrosine-protein kinase, serves as a critical cell surface receptor for neuregulins. Activated by neuregulin-1 (NRG1), ligand binding enhances phosphorylation on tyrosine residues and facilitates its interaction with the p85 subunit of phosphatidylinositol 3-kinase. Additionally, there is evidence suggesting activation by CSPG5. HER3 is intricately involved in the regulation of myeloid cell differentiation, highlighting its pivotal role in cellular processes crucial for normal development and function.

Biological Activity

This product does not contain protein kinase domain.

Species

Human

Source

HEK293

Tag

C-His;C-Avi

Accession

P21860-1 (S20-T643)

Gene ID

2065

Protein Length

Extracellular Domain

Synonyms
ERBB3; HER3; LCCS2; MDA-BF-1; MGC88033; c-erbB3; erbB3-S; p180-ErbB3; p45-sErbB3; p85-sErbB3
AA Sequence

SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLT

Predicted Molecular Mass
71.6 kDa
Molecular Weight

Approximately 72-90 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 1 year from date of receipt, protect from light. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FITC-labeled HER3 Protein, Human (HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FITC-labeled HER3 Protein, Human (HEK293, His-Avi)
Cat. No.:
HY-P701281
Quantity:
MCE Japan Authorized Agent: