FKBP12 Protein, Mouse (His)

The FKBP12 protein is multifunctional and critical in TGF-β signaling by maintaining TGFBR1 in an inactive conformation, thereby preventing receptor activation in the absence of ligand. It recruits SMAD7 to ACVR1B, blocks the binding of SMAD2 and SMAD3 to the activin receptor complex, and thereby inhibits activin signaling. FKBP12 Protein, Mouse (His) is the recombinant mouse-derived FKBP12 protein, expressed by E. coli , with N-His labeled tag. The total length of FKBP12 Protein, Mouse (His) is 107 a.a., with molecular weight of ~13 KDa.

FKBP12, a multifunctional protein, plays a crucial role in maintaining the inactive conformation of TGFBR1, the serine/threonine kinase receptor for TGF-beta, thereby preventing receptor activation in the absence of ligand. This regulatory function contributes to the precise control of TGF-beta signaling. Additionally, FKBP12 recruits SMAD7 to ACVR1B, impeding the association of SMAD2 and SMAD3 with the activin receptor complex and effectively blocking activin signaling. Beyond its role in TGF-beta and activin pathways, FKBP12 exhibits versatility by potentially modulating the activity of the RYR1 calcium channel. Acting as a peptidyl-prolyl cis-trans isomerase (PPIase), FKBP12 accelerates protein folding by catalyzing the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. This diverse array of functions underscores FKBP12's significance in cellular processes and highlights its involvement in various signaling pathways.

Measured by its ability to convert the substrate, Suc-AAPF-pNA, from Cis to Trans formation. The specific activity is 7800 pmol/min/μg, as measured under the described conditions.

Mouse

E. coli

N-6*His

P26883 (G2-E108)

14225  [NCBI]

GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISSDYAYGATGHPGIIPPHATLVFDVELLKLE

Approximately 13 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.