1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Activin/Inhibins Receptor
  5. Follistatin
  6. Follistatin/FST Protein, Mouse (CHO, Fc)

Follistatin (FST) is a regulator of TGFβ family signaling and acts by selectively binding to TGFβ family ligands and preventing ligand binding to the receptor complex. Follistatin has the ability to suppress the follicle stimulating hormone (FSH). Follistatin/FST Protein, Mouse (CHO, Fc) is produced in CHO cells with a C-Terminal Fc-tag. It consists of 317 amino acids (M1-N317).

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
20 μg 견적 받기
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

Follistatin (FST) is a regulator of TGFβ family signaling and acts by selectively binding to TGFβ family ligands and preventing ligand binding to the receptor complex. Follistatin has the ability to suppress the follicle stimulating hormone (FSH)[1][2]. Follistatin/FST Protein, Mouse (CHO, Fc) is produced in CHO cells with a C-Terminal Fc-tag. It consists of 317 amino acids (M1-N317).

Background

Follistatin is first described as a follicle-stimulating hormone inhibiting substance present in ovarian follicular fluid. Follistatin binds activin A and myostatin with low nanomolar (nM) affinity, completely surrounds the ligand occluding all of the receptor binding sites and binds to the ligand[1][2].
Mature human Follistatin shares 97% amino acid sequence identity with mouse and rat Follistatin.
Follistatin is a 32-35-kDa glycoprotein composed of four domains including an N-terminal domain (ND) followed by three Follistatin domains (FSD1, FSD2, and FSD3). C-terminal splicing of Follistatin can occur to generate various isoforms including FS288 and FS315. Follistatin neutralizes the TGFβ ligands, myostatin and activin A, by forming a nearly irreversible non-signaling complex by surrounding the ligand and preventing interaction with TGFβ receptors. In humans, the gene encoding Follistatin is located on chromosome 5q11.2. The Follistatin protein contains a TGF-β binding site where activins, bone morphonegic proteins (BMPs) and growth differentiation factors (GDFs) are bound with high affinity and thereby neutralised. The ligand binding site for Follistatin overlaps with the type I and type II receptor binding sites for these ligands. Follistatin also contains a heparin binding site where proteoglycans in the extracellular matrix can bind, and therefore Follistatin is believed to bind the extracellular matrix. There are two major isoforms of Follistatin, FST288, which is anchored to the cell surface by interactions with heparin sulfate proteoglycans, and FST315, which is the predominant form found in circulation. The two isoforms arise from alternative splicing; the 315 isoform includes a 27 amino acid acidic C-terminal tail, which Follistatin 288 does not have. The acidic tail on Follistatin 315 neutralises the heparin binding site, thereby inhibiting the binding of Follistatin 315 to the extracellular matrix[1][2][3].
Follistatin as a liver-derived protein under the regulation of glucagon-to-insulin ratio suggests a relation to energy metabolism. In humans, aberrant expression of FST and activins are implicated in infertility. Follistatin is a potent tissue regulator in the gonad, pituitary gland, pregnancy membranes, vasculature, and liver[1][3].

In Vitro

Recombinant mouse Follistatin (0.2 μg/mL; 1-48 hours) significantly inhibits P21 mRNA expression, and increases Pcna and Cyclin D2 mRNA expression in CD49f positive cells (CD49f+ cells) isolated from male murine salivary glands[4].

In Vivo

Recombinant mouse Follistatin (0.05-1 μg; four does) is administered intranasally (50 μL) 1 h before each challenge in ovalbumin-sensitized BALB/c mice. Follistatin inhibits the allergen-specific Th2 immune response in mediastinal lymph nodes and mucus production in the lung[5].

Biological Activity

Measured by its ability to neutralize Activin-mediated inhibition on MPC11 cell proliferation and the ED50 is typically 29-200 ng/mL in the presence of 10 ng/mL rhActivin A.

Species

Mouse

Source

CHO

Tag

C-hFc

Accession

P47931-1 (G30-N317)

Gene ID
Molecular Construction
N-term
Follistatin/FST (G30-N317)
Accession # P47931-1
hFc
C-term
Protein Length

Partial

Synonyms
Follistatin; FS; Activin-binding protein; FST
AA Sequence

GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKKCLWDSKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN

분자량

Approximately 66 kDa

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References

Follistatin/FST Protein, Mouse (CHO, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Follistatin/FST Protein, Mouse (CHO, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Follistatin/FST Protein, Mouse (CHO, Fc)
Cat. No.:
HY-P74148
수량:
MCE Japan Authorized Agent: