1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Epithelial cell CD Proteins Endothelial cell CD Proteins G-Protein-Coupled Receptors (GPCRs)
  4. Frizzled-4/CD344 Frizzled
  5. Frizzled-4/CD344 Protein, Human (HEK293, Fc)

The Frizzled-4/CD344 protein is a receptor for Wnt proteins and is associated with the classical β-catenin pathway, activating disheveled proteins, inhibiting GSK-3 kinase, and triggering Wnt target genes. In retinal vascularization, it acts as a receptor for Wnt proteins and Norrin (NDP), stimulating β-catenin accumulation and LEF/TCF-mediated transcription. Frizzled-4/CD344 Protein, Human (HEK293, Fc) is the recombinant human-derived Frizzled-4/CD344 protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The Frizzled-4/CD344 protein is a receptor for Wnt proteins and is associated with the classical β-catenin pathway, activating disheveled proteins, inhibiting GSK-3 kinase, and triggering Wnt target genes. In retinal vascularization, it acts as a receptor for Wnt proteins and Norrin (NDP), stimulating β-catenin accumulation and LEF/TCF-mediated transcription. Frizzled-4/CD344 Protein, Human (HEK293, Fc) is the recombinant human-derived Frizzled-4/CD344 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Frizzled-4/CD344 Protein serves as a receptor for Wnt proteins, particularly associated with the canonical beta-catenin signaling pathway, involving the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and subsequent activation of Wnt target genes. In the context of retinal vascularization, Frizzled-4 plays a pivotal role by acting as a receptor for both Wnt proteins and norrin (NDP), facilitating beta-catenin accumulation and stimulation of LEF/TCF-mediated transcriptional programs. Although a secondary signaling pathway, featuring PKC and calcium fluxes, has been observed in some family members, its integration with the canonical pathway, particularly in the context of Wnt-mediated inactivation of GSK-3 kinase, remains uncertain. Frizzled-4's involvement in tissue morphogenesis and intercellular transmission of polarity information is suggested, with interactions observed with MAGI3, NDP, TSKU, and glypican GPC3, highlighting its intricate role in cellular processes and signaling cascades.

Biological Activity

Immobilized rmWnt-5a (HY-P704313) at 100 ng/mL (100 μL/well) can bind Frizzled-4/CD344, the ED50 for this effect is 1.740 μg/mL.

  • Immobilized rmWnt-5a (HY-P704313) at 100 ng/mL (100 μL/well) can bind Frizzled-4/CD344, the ED50 for this effect is 1.740 μg/mL.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q9ULV1 (F37-E180)

Gene ID
Molecular Construction
N-term
Frizzled-4/CD344 (F37-E180)
Accession # Q9ULV1
hFc
C-term
Protein Length

Partial

Synonyms
CD344 antigen; CD344; EVR1; FEVR; Frizzled-4; Fz-4; FZD4
AA Sequence

FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE

분자량

Approximately 43.3 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Frizzled-4/CD344 Protein, Human (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Frizzled-4/CD344 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P74141
수량:
MCE Japan Authorized Agent: