Copy Link Print Information

FSH Protein, Human (HEK293, Fc)

5 Cited Publications
Customer Review

Based on 5 publication(s) in Google Scholar

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. FSH Protein, Human (HEK293, Fc) is a recombinant protein dimer complex containing human-derived FSH protein, expressed by HEK293 , with C-hFc labeled tag. FSH Protein, Human (HEK293, Fc), has molecular weight of ~23-24.3 & 45-49 kDa, respectively.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FSH Protein, Human (HEK293, Fc)
  • Experimental Validation Results for FSH Protein, Human (HEK293, Fc)
  • Experimental Validation Results for FSH Protein, Human (HEK293, Fc)
  • Experimental Validation Results for FSH Protein, Human (HEK293, Fc)
  • Experimental Validation Results for FSH Protein, Human (HEK293, Fc)
  • Experimental Validation Results for FSH Protein, Human (HEK293, Fc)
  • FSH Protein, Human (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. FSH Protein, Human (HEK293, Fc) is a recombinant protein dimer complex containing human-derived FSH protein, expressed by HEK293 , with C-hFc labeled tag. FSH Protein, Human (HEK293, Fc), has molecular weight of ~23-24.3 & 45-49 kDa, respectively.

Background

The CG alpha protein serves as the shared alpha chain in the active heterodimeric glycoprotein hormones, including thyrotropin (TSH), lutropin (LH), follitropin (FSH), and choriogonadotropin (CG). These hormones bind to specific receptors on target cells, initiating downstream signaling pathways. The heterodimeric structure of these hormones involves the CG alpha chain, as described here, and a unique beta chain, which imparts biological specificity to each hormone. Specifically, TSH consists of CG alpha and TSH beta (TSHB), lutropin comprises CG alpha and LH beta (LHB), follitropin includes CG alpha and FSH beta (FSHB), and choriogonadotropin is composed of CG alpha and choriogonadotropin subunit beta (CGB).

Verified Bioactivity

1.Measured in a cell proliferation assay using SK-OV-3 cells. The ED50 for this effect is ≤0.076 ng/mL, corresponding to a specific activity is ≥1.316×107 units/mg.
2.Measured by its ability to induce cAMP accumulation in HEK293 human embryonic kidney cells transfected with human FSH R. The ED50 for this effect is <0.2 ng/mL.
3.Immobilized Human FSHR (HY-P72198) at 2 μg/mL (100 μL/well) can bind Human FSH Fc. The ED50 for this effect is 1.099 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using SK-OV-3 cells. The ED50 for this effect is 0.055 ng/mL, corresponding to a specific activity is 1.82×107 units/mg.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Human FSHR at 2 μg/mL (100 μL/well) can bind Human FSH Fc (HY-P74133). The ED50 for this effect is 1.099 μg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession

    P01215 (A25-S116)&P01225 (N19-E129)

  • Gene ID
    1081  [NCBI]&2488  [NCBI]
  • Synonyms

    CGA; Anterior Pituitary Glycoprotein Hormones Common Subunit Alpha; Glycoprotein Hormones, Alpha Polypeptide; Follicle-Stimulating Hormone Alpha Subunit; Glycoprotein Hormones Alpha Chain; Chorionic Gonadotropin, Alpha Polypeptide; GPA1; Follicle-Stimulat

  • AA Sequence

    APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
    &:
    NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

  • Molecular Weight

    Approximately 23-24.3 & 45-49 kDa

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using SK-OV-3 cells. The ED50 for this effect is 0.055 ng/mL, corresponding to a specific activity is 1.82×107 units/mg.

  • 1/16

    MedChemExpress Validation
     Immobilized Human FSHR at 2 μg/mL (100 μL/well) can bind Human FSH Fc (HY-P74133). The ED50 for this effect is 1.099 μg/mL.

  • 1/16

    FSH Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Life Sci. 2026 Jan 15:385:124121. [Abstract]

    Customer Validation
     SH Protein, Human (HEK293, Fc) (30 ng/mL; 14 days) showed an average 72 % reduction in mineralized area, confirming FSH-mediated suppression of osteogenesis. control (Ctrl), basal medium +30 ng/mL recombinant human FSH (rhFSH; FSH Protein, Human (HEK293, Fc)); and knockout group (cKO), 30 ng/mL rhFSH +1 μM 4-hydroxytamoxifen.

  • 1/16

    FSH Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Life Sci. 2026 Jan 15:385:124121. [Abstract]

    Customer Validation
     SH Protein, Human (HEK293, Fc) (30 ng/mL; 14 days) downregulated the osteogenic markers COL1A1 and EPHA2 in Ctrl cells compared to blank cells. In contrast, Fshr knockout partially restored their expression, resulting in upregulated levels of these osteogenic markers in cKO cells compared to the Ctrl group. control (Ctrl), basal medium +30 ng/mL recombinant human FSH (rhFSH); and knockout group (cKO), 30 ng/mL rhFSH +1 μM 4-hydroxytamoxifen.

  • 1/16

    FSH Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Life Sci. 2026 Jan 15:385:124121. [Abstract]

    Customer Validation
     FSH Protein, Human (HEK293, Fc) (30 ng/mL; 14 days) reduced phosphorylated PI3K and Akt (p-PI3K and p-Akt, respectively) levels, but were restored by Fshr deletion in cKO cells.

  • FSH Protein, Human (HEK293, Fc) Product Image
    1/16
  • Experimental Validation Results for FSH Protein, Human (HEK293, Fc)
  • Experimental Validation Results for FSH Protein, Human (HEK293, Fc)
  • Experimental Validation Results for FSH Protein, Human (HEK293, Fc)
  • Experimental Validation Results for FSH Protein, Human (HEK293, Fc)
  • Experimental Validation Results for FSH Protein, Human (HEK293, Fc)
  • Experimental Validation Results for FSH Protein, Human (HEK293, Fc)
  • FSH Protein, Human (HEK293, Fc) Product Image

  • FSH Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Life Sci. 2026 Jan 15:385:124121. [Abstract]

    SH Protein, Human (HEK293, Fc) (30 ng/mL; 14 days) showed an average 72 % reduction in mineralized area, confirming FSH-mediated suppression of osteogenesis. control (Ctrl), basal medium +30 ng/mL recombinant human FSH (rhFSH; FSH Protein, Human (HEK293, Fc)); and knockout group (cKO), 30 ng/mL rhFSH +1 μM 4-hydroxytamoxifen.

  • FSH Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Life Sci. 2026 Jan 15:385:124121. [Abstract]

    SH Protein, Human (HEK293, Fc) (30 ng/mL; 14 days) downregulated the osteogenic markers COL1A1 and EPHA2 in Ctrl cells compared to blank cells. In contrast, Fshr knockout partially restored their expression, resulting in upregulated levels of these osteogenic markers in cKO cells compared to the Ctrl group. control (Ctrl), basal medium +30 ng/mL recombinant human FSH (rhFSH); and knockout group (cKO), 30 ng/mL rhFSH +1 μM 4-hydroxytamoxifen.

  • FSH Protein, Human (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: Life Sci. 2026 Jan 15:385:124121. [Abstract]

    FSH Protein, Human (HEK293, Fc) (30 ng/mL; 14 days) reduced phosphorylated PI3K and Akt (p-PI3K and p-Akt, respectively) levels, but were restored by Fshr deletion in cKO cells.