FSH Protein, Human (HEK293, Fc)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. FSH Protein, Human (HEK293, Fc) is a recombinant protein dimer complex containing human-derived FSH protein, expressed by HEK293 , with C-hFc labeled tag. FSH Protein, Human (HEK293, Fc), has molecular weight of ~23-24.3 & 45-49 kDa, respectively.

The CG alpha protein serves as the shared alpha chain in the active heterodimeric glycoprotein hormones, including thyrotropin (TSH), lutropin (LH), follitropin (FSH), and choriogonadotropin (CG). These hormones bind to specific receptors on target cells, initiating downstream signaling pathways. The heterodimeric structure of these hormones involves the CG alpha chain, as described here, and a unique beta chain, which imparts biological specificity to each hormone. Specifically, TSH consists of CG alpha and TSH beta (TSHB), lutropin comprises CG alpha and LH beta (LHB), follitropin includes CG alpha and FSH beta (FSHB), and choriogonadotropin is composed of CG alpha and choriogonadotropin subunit beta (CGB).

1.Measured in a cell proliferation assay using SK-OV-3 cells. The ED₅₀ for this effect is ≤0.076 ng/mL, corresponding to a specific activity is ≥1.316×10⁷ units/mg.
2.Measured by its ability to induce cAMP accumulation in HEK293 human embryonic kidney cells transfected with human FSH R. The ED₅₀ for this effect is <0.2 ng/mL.

• 
  Measured in a cell proliferation assay using SK-OV-3 cells. The ED₅₀ for this effect is 0.055 ng/mL, corresponding to a specific activity is 1.82×10₇ units/mg.

Human

HEK293

C-hFc

P01215 (A25-S116)&P01225 (N19-E129)

1081  [NCBI]&2488  [NCBI]

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
&:
NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Approximately 23-24.3 & 45-49 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.