Copy Link Print Information

FSH Protein, Human (HEK293, Flag-His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Follicle-stimulating hormone (FSH) is a glycoprotein dimer polypeptide hormone produced by the anterior pituitary in response to gonadotropin-releasing hormone (GnRH) from the hypothalamus, which consists of Glycoprotein hormones α chain and Follitropin subunit β. FSH binds to FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. FSH is involved in follicle development and spermatogenesis in reproductive organs. FSH Protein, Human (HEK293, Flag-His) is a recombinant protein with a Flag-His label that consisting of 116 amino acids of Glycoprotein hormones α chain and 129 amino acids of Follitropin subunit β, which is expressed in HEK293 cells.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FSH Protein, Human (HEK293, Flag-His)
  • Experimental Validation Results for FSH Protein, Human (HEK293, Flag-His)
  • FSH Protein, Human (HEK293, Flag-His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Follicle-stimulating hormone (FSH) is a glycoprotein dimer polypeptide hormone produced by the anterior pituitary in response to gonadotropin-releasing hormone (GnRH) from the hypothalamus, which consists of Glycoprotein hormones α chain and Follitropin subunit β. FSH binds to FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. FSH is involved in follicle development and spermatogenesis in reproductive organs. FSH Protein, Human (HEK293, Flag-His) is a recombinant protein with a Flag-His label that consisting of 116 amino acids of Glycoprotein hormones α chain and 129 amino acids of Follitropin subunit β, which is expressed in HEK293 cells[1][2][3][4][5][6][7][8][9].

Background

FSH Protein (Human) is a glycoprotein dimer with α and β subunits. The β subunit is unique to FSH, while the α subunit is shared as same as in thyroid stimulating hormone (TSH), choriogonadotropin (CG) and luteinizing hormone (LH)[1].
Follicle growth is directly dependent on FSH Protein (Human) stimulation. Granulosa cells from small follicles express FSH Protein (Human) receptors and respond to FSH Protein (Human) stimulation by synthesizing aromatase[1].
FSH Protein (Human) release is stimulated by gonadotropin-releasing hormone (GnRH): The hypothalamus produces GnRH, and it is released into the hypophyseal portal circulation to act on G-protein-coupled receptors at gonadotropic cells of the anterior pituitary. Gonadotropic cells produce FSH and luteinizing hormone (LH) and release them into the peripheral circulation[4].
FSH Protein (Human) regulates the development, growth, pubertal maturation and reproductive processes of the human body. FSH Protein (Human) is used commonly in infertility therapy, mainly for ovarian hyperstimulation. In some cases, it is used in ovulation induction for reversal of anovulation as well[5].
FSH Protein (Human) secretion is inhibited by negative feedback from estrogen levels in women and FSH Protein (Human) secretion is inhibited by levels of inhibin B (secreted by the Sertoli cells) via negative feedback in men[5,6].
FSH Protein (Human) Levels are associated with various diseases, such as Polycystic Ovarian Syndrome, male infertility, hypogonadotropic hypogonadism, Kallman Syndrome, Turner Syndrome, pituitary adenomas, and more[1,7,8,9].

In Vitro

The serum level of FSH Protein (Human) (13.7, 24.1 and 69 IU/L) increases as ovarian function declines, which acts a better predictor of in vitro fertilization (IVF) performance than age[3].

In Vivo

The plasma concentration of FSH Protein (Human) is profoundly reduced when a variety of α-adrenergic blocking agents interrupts the pulsatile discharges in ovariectomized rhesus monkeys, which suggests the production and secretion of FSH are critically dependent on hypothalamic GnRH[3].

Verified Bioactivity

1. Measured in a cell proliferation assay using SK-OV-3 cells. The ED50 for this effect is 0.048 ng/mL, corresponding to a specific activity is 2.083×107 units/mg.
2. Human FSHR immobilized on CM5 Chip can bind FSH with an affinity constant of 102.9 nM as determined in a SPR assay.
3.Measured by its ability to induce cAMP accumulation in HEK293 human embryonic kidney cells transfected with human FSH R. The ED50 for this effect is <200 pg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using SK-OV-3 cells. The ED50 for this effect is 0.048 ng/mL, corresponding to a specific activity is 2.083×107 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Flag;C-6*His
  • Accession

    P01215 (A25-S116)&P01225 (N19-E129)

  • Gene ID
    1081  [NCBI]&2488  [NCBI]
  • Synonyms

    CGA; Anterior Pituitary Glycoprotein Hormones Common Subunit Alpha; Glycoprotein Hormones, Alpha Polypeptide; Follicle-Stimulating Hormone Alpha Subunit; Glycoprotein Hormones Alpha Chain; Chorionic Gonadotropin, Alpha Polypeptide; GPA1; Follicle-Stimulat

  • AA Sequence

    APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS&NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

  • Molecular Weight

    Approximately 20-30 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Barbieri RL. The endocrinology of the menstrual cycle. Methods Mol Biol. 2014;1154:145-69. [Content Brief]

[2]. Toner JP, et al. Basal follicle-stimulating hormone level is a better predictor of in vitro fertilization performance than age. Fertil Steril. 1991 Apr;55(4):784-91. [Content Brief]

[3]. Knobil E. The neuroendocrine control of the menstrual cycle. Recent Prog Horm Res. 1980;36:53-88. [Content Brief]

[4]. Yonkers KA, et al. Premenstrual disorders. Am J Obstet Gynecol. 2018 Jan;218(1):68-74. [Content Brief]

[5]. Shaw ND, et al. Estrogen negative feedback on gonadotropin secretion: evidence for a direct pituitary effect in women. J Clin Endocrinol Metab. 2010 Apr;95(4):1955-61. [Content Brief]

[6]. Boepple PA, et al. Relative roles of inhibin B and sex steroids in the negative feedback regulation of follicle-stimulating hormone in men across the full spectrum of seminiferous epithelium function. J Clin Endocrinol Metab. 2008 May;93(5):1809-14. [Content Brief]

[7]. Nieschlag E, et al. Role of FSH in the regulation of spermatogenesis: clinical aspects. Clin Endocrinol (Oxf). 1999 Aug;51(2):139-46. [Content Brief]

[8]. Stamatiades GA, et al. Gonadotropin regulation by pulsatile GnRH: Signaling and gene expression. Mol Cell Endocrinol. 2018 Mar 5;463:131-141. [Content Brief]

[9]. Pouresmaeili F, et al. Premature ovarian failure: a critical condition in the reproductive potential with various genetic causes. Int J Fertil Steril. 2014 Apr;8(1):1-12. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using SK-OV-3 cells. The ED50 for this effect is 0.048 ng/mL, corresponding to a specific activity is 2.083×107 units/mg.

  • FSH Protein, Human (HEK293, Flag-His) Product Image
    1/16
  • Experimental Validation Results for FSH Protein, Human (HEK293, Flag-His)
  • Experimental Validation Results for FSH Protein, Human (HEK293, Flag-His)
  • FSH Protein, Human (HEK293, Flag-His) Product Image