1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. FSH
  5. FSH Protein, Human (HEK293, Flag-His)

FSH Protein, Human (HEK293, Flag-His)

Cat. No.: HY-P70237
COA Handling Instructions

FSH Protein, Human (HEK293, Flag-His) is a recombinant Human Follicle-stimulating hormone (FSH) produced in HEK293 cells, with Flag-His tag. FSH is a glycoprotein polypeptide hormone.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $60 In-stock
10 μg $170 In-stock
50 μg $510 In-stock
100 μg $918 Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

FSH Protein, Human (HEK293, Flag-His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

FSH Protein, Human (HEK293, Flag-His) is a recombinant Human Follicle-stimulating hormone (FSH) produced in HEK293 cells, with Flag-His tag. FSH is a glycoprotein polypeptide hormone[1].

Background

Follicle-stimulating hormone (FSH) is a hormone produced by the anterior pituitary in response to gonadotropin-releasing hormone (GnRH) from the hypothalamus. FSH is a glycoprotein dimer with alpha and beta subunits. FSH plays a role in sexual development and reproduction in both males and females[1].

Biological Activity

Measured in a cell proliferation assay using SK-OV-3 cells. The ED50 for this effect is 0.048 ng/mL, corresponding to a specific activity is 2.083×107 units/mg.

Species

Human

Source

HEK293

Tag

C-Flag;C-6*His

Accession

P01215 (A25-S116) & P01225 (N19-E129)

Gene ID

1081  [NCBI]&2488  [NCBI]

Synonyms
rHuFollicle-stimulating hormone/FSH, Flag-His; Follicle-stimulating hormone; FSH; FSH alpha/beta
AA Sequence

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS&NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Molecular Weight

Approximately 19-30 kDa due to the glycosylation

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

FSH Protein, Human (HEK293, Flag-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FSH Protein, Human (HEK293, Flag-His)
Cat. No.:
HY-P70237
Quantity:
MCE Japan Authorized Agent: