FZD2 Protein, Mouse (HEK293, Fc)

FZD2 is a Wnt receptor that primarily activates the β-catenin classical pathway, involving disheveled protein, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Although some family members exhibit second PKC and calcium flux pathways, the precise differentiation and integration with the canonical pathways remains unclear. FZD2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived FZD2 protein, expressed by HEK293 , with C-hFc labeled tag.

FZD2, functioning as a receptor for Wnt proteins, is predominantly associated with the beta-catenin canonical signaling pathway, orchestrating the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and activation of Wnt target genes. While certain family members exhibit a second signaling pathway involving PKC and calcium fluxes, the precise distinction and potential integration with the canonical pathway remain unclear, with PKC appearing crucial for Wnt-mediated GSK-3 kinase inactivation. Both pathways entail interactions with G-proteins. FZD2's potential involvement in transducing polarity information during tissue morphogenesis and/or in differentiated tissues further underscores its intricate role in cellular processes.

Mouse

HEK293

C-hFc

Q9JIP6 (Q29-L168)

57265  [NCBI]

Partial

QFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPAL

Approximately 55-60 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.