1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. Frizzled
  5. Frizzled-2
  6. FZD2 Protein, Mouse (HEK293, Fc)

FZD2 Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P70918
Handling Instructions

FZD2 is a Wnt receptor that primarily activates the β-catenin classical pathway, involving disheveled protein, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Although some family members exhibit second PKC and calcium flux pathways, the precise differentiation and integration with the canonical pathways remains unclear. FZD2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived FZD2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of FZD2 Protein, Mouse (HEK293, Fc) is 140 a.a., with molecular weight of 55-60 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FZD2 is a Wnt receptor that primarily activates the β-catenin classical pathway, involving disheveled protein, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Although some family members exhibit second PKC and calcium flux pathways, the precise differentiation and integration with the canonical pathways remains unclear. FZD2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived FZD2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of FZD2 Protein, Mouse (HEK293, Fc) is 140 a.a., with molecular weight of 55-60 kDa.

Background

FZD2, functioning as a receptor for Wnt proteins, is predominantly associated with the beta-catenin canonical signaling pathway, orchestrating the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and activation of Wnt target genes. While certain family members exhibit a second signaling pathway involving PKC and calcium fluxes, the precise distinction and potential integration with the canonical pathway remain unclear, with PKC appearing crucial for Wnt-mediated GSK-3 kinase inactivation. Both pathways entail interactions with G-proteins. FZD2's potential involvement in transducing polarity information during tissue morphogenesis and/or in differentiated tissues further underscores its intricate role in cellular processes.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q9JIP6 (Q29-L168)

Gene ID

57265  [NCBI]

Molecular Construction
N-term
FZD2 (Q29-L168)
Accession # Q9JIP6
hFc
C-term
Synonyms
Frizzled-2; Fz-2; mFz2; Fzd2; frizzled (Drosophila) homolog 2
AA Sequence

QFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPAL

Molecular Weight

55-60 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FZD2 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FZD2 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P70918
Quantity:
MCE Japan Authorized Agent: