FZD2 Protein, Mouse (HEK293, Fc)
FZD2 is a Wnt receptor that primarily activates the β-catenin classical pathway, involving disheveled protein, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Although some family members exhibit second PKC and calcium flux pathways, the precise differentiation and integration with the canonical pathways remains unclear. FZD2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived FZD2 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FZD2 is a Wnt receptor that primarily activates the β-catenin classical pathway, involving disheveled protein, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Although some family members exhibit second PKC and calcium flux pathways, the precise differentiation and integration with the canonical pathways remains unclear. FZD2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived FZD2 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
FZD2, functioning as a receptor for Wnt proteins, is predominantly associated with the beta-catenin canonical signaling pathway, orchestrating the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and activation of Wnt target genes. While certain family members exhibit a second signaling pathway involving PKC and calcium fluxes, the precise distinction and potential integration with the canonical pathway remain unclear, with PKC appearing crucial for Wnt-mediated GSK-3 kinase inactivation. Both pathways entail interactions with G-proteins. FZD2's potential involvement in transducing polarity information during tissue morphogenesis and/or in differentiated tissues further underscores its intricate role in cellular processes.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9JIP6 (Q29-L168)
-
Molecular Construction
-
N-term
-
FZD2 (Q29-L168)
Accession # Q9JIP6 -
hFc
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
FZD2; HFz2; Frizzled Class Receptor 2; Frizzled (Drosophila) Homolog 2; Frizzled-2; Frizzled Homolog 2 (Drosophila); Frizzled 2, Seven Transmembrane Spanning Receptor; Frizzled Homolog 2; Frizzled Family Receptor 2; OMOD2; Fz-2; Fz2; FzE2
-
AA Sequence
QFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPAL
-
Predicted Molecular Mass
42.9 kDa
-
Molecular Weight
Approximately 55-60 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
