1. Recombinant Proteins
  2. Others
  3. Galectin-8/LGALS8 Protein, Human (GST)

Galectin-8/LGALS8 protein is an important enzyme in the glycosylation process, acting as β-1,3-N-acetylglucosaminyltransferase to synthesize poly-N-acetyllactosamine. Galectin-8/LGALS8 is essential for modifying glycoproteins and glycolipids, catalyzes the transfer of N-acetylglucosamine to acceptor molecules, and exhibits specific activity on type 2 oligosaccharides. Galectin-8/LGALS8 Protein, Human (GST) is the recombinant human-derived Galectin-8/LGALS8 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Galectin-8/LGALS8 protein is an important enzyme in the glycosylation process, acting as β-1,3-N-acetylglucosaminyltransferase to synthesize poly-N-acetyllactosamine. Galectin-8/LGALS8 is essential for modifying glycoproteins and glycolipids, catalyzes the transfer of N-acetylglucosamine to acceptor molecules, and exhibits specific activity on type 2 oligosaccharides. Galectin-8/LGALS8 Protein, Human (GST) is the recombinant human-derived Galectin-8/LGALS8 protein, expressed by E. coli , with N-GST labeled tag.

Background

Galectin-8 (Gal-8), encoded by LGALS8 gene, is a unique member of the Galectin family with diverse biological functions, including tumor-modulating capabilities. Galectin-8 is involved in regulating innate and adaptive immunity, and is highly expressed in tumors and other immune disorders. Galectin-8 as a functional ligand of LILRB, which induced MDSC expansion and promoted tumor progression in vivo. Galectin-8, encoded by the LGALS8 gene, is a member of mammalian lectins with unique features, which emerged as an immune regulator of both innate and adaptive immunity[1].

Species

Human

Source

E. coli

Tag

N-GST

Accession

O00214-1 (M1-W317)

Gene ID
Molecular Construction
N-term
GST
LGALS8 (M1-W317)
Accession # O00214-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
LGALS8; lectin, galactoside-binding, soluble, 8; galectin-8; galectin 8; PCTA 1; galectin-8g; Po66 carbohydrate binding protein; po66 carbohydrate-binding protein; prostate carcinoma tumor antigen 1; Gal-8; PCTA1; PCTA-1; Po66-CBP;
AA Sequence

MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW

Predicted Molecular Mass
62.8 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

Galectin-8/LGALS8 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Galectin-8/LGALS8 Protein, Human (GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Galectin-8/LGALS8 Protein, Human (GST)
Cat. No.:
HY-P700382
Quantity:
MCE Japan Authorized Agent: