Galectin-8/LGALS8 Protein, Human (GST)
Galectin-8/LGALS8 protein is an important enzyme in the glycosylation process, acting as β-1,3-N-acetylglucosaminyltransferase to synthesize poly-N-acetyllactosamine. Galectin-8/LGALS8 is essential for modifying glycoproteins and glycolipids, catalyzes the transfer of N-acetylglucosamine to acceptor molecules, and exhibits specific activity on type 2 oligosaccharides. Galectin-8/LGALS8 Protein, Human (GST) is the recombinant human-derived Galectin-8/LGALS8 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Galectin-8/LGALS8 protein is an important enzyme in the glycosylation process, acting as β-1,3-N-acetylglucosaminyltransferase to synthesize poly-N-acetyllactosamine. Galectin-8/LGALS8 is essential for modifying glycoproteins and glycolipids, catalyzes the transfer of N-acetylglucosamine to acceptor molecules, and exhibits specific activity on type 2 oligosaccharides. Galectin-8/LGALS8 Protein, Human (GST) is the recombinant human-derived Galectin-8/LGALS8 protein, expressed by E. coli , with N-GST labeled tag.
Background
Galectin-8 (Gal-8), encoded by LGALS8 gene, is a unique member of the Galectin family with diverse biological functions, including tumor-modulating capabilities. Galectin-8 is involved in regulating innate and adaptive immunity, and is highly expressed in tumors and other immune disorders. Galectin-8 as a functional ligand of LILRB, which induced MDSC expansion and promoted tumor progression in vivo. Galectin-8, encoded by the LGALS8 gene, is a member of mammalian lectins with unique features, which emerged as an immune regulator of both innate and adaptive immunity[1].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
O00214-1 (M1-W317)
-
Molecular Construction
-
N-term
-
GST
-
LGALS8 (M1-W317)
Accession # O00214-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
LGALS8; Galectin-8; Galectin 8; Po66-CBP; PCTA-1; Gal-8; Lectin, Galactoside-Binding, Soluble, 8; Po66 Carbohydrate Binding Protein; Prostate Carcinoma Tumor Antigen 1; Alternative Protein LGALS8; Po66 Carbohydrate-Binding Protein; Galectin; Galectin-8g;
-
AA Sequence
MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
-
Predicted Molecular Mass
62.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
