1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Inhibitory Checkpoint Molecules
  4. Galectin-9
  5. Galectin-9/LGALS9 Protein, Human (HEK293, His)

Galectin-9/LGALS9 Protein, Human (HEK293, His)

Cat. No.: HY-P70535
Handling Instructions Technical Support

Galectin-9/LGALS9 Protein acts as an eosinophil chemoattractant, recruiting and migrating eosinophils, key immune cells in inflammatory responses. It also serves as an angiogenesis inhibitor, regulating blood vessel formation and impacting vascular processes. Functioning as a regulatory modulator, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways. Galectin-9/LGALS9 Protein, Human (HEK293, His) is the recombinant human-derived Galectin-9/LGALS9 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Galectin-9/LGALS9 Protein acts as an eosinophil chemoattractant, recruiting and migrating eosinophils, key immune cells in inflammatory responses. It also serves as an angiogenesis inhibitor, regulating blood vessel formation and impacting vascular processes. Functioning as a regulatory modulator, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways. Galectin-9/LGALS9 Protein, Human (HEK293, His) is the recombinant human-derived Galectin-9/LGALS9 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Galectin-9/LGALS9 protein functions as an eosinophil chemoattractant, actively participating in the recruitment and migration of eosinophils, crucial immune cells involved in inflammatory responses. Moreover, it serves as an angiogenesis inhibitor, contributing to the regulation of blood vessel formation and impacting vascular processes. In its role as a regulatory modulator of immune responses, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways (By similarity).

Biological Activity

Measured by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. The ED50 for this effect is ≤0.4126 μg/mL.

  • Measured by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. The ED50 for this effect is 0.4007 μg/mL, corresponding to a specific activity is 2495.633 units/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

O00182-2 (M1-T323)

Gene ID
Molecular Construction
N-term
LGALS9 (M1-T323)
Accession # O00182-2
6*His
C-term
Synonyms
Galectin-9; Gal-9; Ecalectin; Tumor Antigen HOM-HD-21; LGALS9
AA Sequence

MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

Molecular Weight

Approximately 43-55 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM MOPS, 150 mM NaCl, 1 mM DTT, 1 mM EDTA, 5% Trehalose, pH 7.4 or PBS, pH 7.4, 5 mM DTT, 1mM EDTA, 8% trehalose or 20 mM His-HCl, 8% Trehalose, 2% Mannitol, 0.05% Tween 80, 1 mM EDTA, 1mM DTT, pH 6.0 or PBS, pH 7.4, 5 mM DTT, 1mM EDTA, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Galectin-9/LGALS9 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Galectin-9/LGALS9 Protein, Human (HEK293, His)
Cat. No.:
HY-P70535
Quantity:
MCE Japan Authorized Agent: