Copy Link Print Information

Galectin-9/LGALS9 Protein, Human (HEK293, His)

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

Galectin-9/LGALS9 Protein acts as an eosinophil chemoattractant, recruiting and migrating eosinophils, key immune cells in inflammatory responses. It also serves as an angiogenesis inhibitor, regulating blood vessel formation and impacting vascular processes. Functioning as a regulatory modulator, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways. Galectin-9/LGALS9 Protein, Human (HEK293, His) is the recombinant human-derived Galectin-9/LGALS9 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Galectin-9/LGALS9 Protein, Human (HEK293, His)
  • Experimental Validation Results for Galectin-9/LGALS9 Protein, Human (HEK293, His)
  • Experimental Validation Results for Galectin-9/LGALS9 Protein, Human (HEK293, His)
  • Experimental Validation Results for Galectin-9/LGALS9 Protein, Human (HEK293, His)
  • Experimental Validation Results for Galectin-9/LGALS9 Protein, Human (HEK293, His)
  • Experimental Validation Results for Galectin-9/LGALS9 Protein, Human (HEK293, His)
  • Experimental Validation Results for Galectin-9/LGALS9 Protein, Human (HEK293, His)
  • Experimental Validation Results for Galectin-9/LGALS9 Protein, Human (HEK293, His)
  • Experimental Validation Results for Galectin-9/LGALS9 Protein, Human (HEK293, His)
  • Galectin-9/LGALS9 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Galectin-9/LGALS9 Protein acts as an eosinophil chemoattractant, recruiting and migrating eosinophils, key immune cells in inflammatory responses. It also serves as an angiogenesis inhibitor, regulating blood vessel formation and impacting vascular processes. Functioning as a regulatory modulator, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways. Galectin-9/LGALS9 Protein, Human (HEK293, His) is the recombinant human-derived Galectin-9/LGALS9 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Galectin-9/LGALS9 protein functions as an eosinophil chemoattractant, actively participating in the recruitment and migration of eosinophils, crucial immune cells involved in inflammatory responses. Moreover, it serves as an angiogenesis inhibitor, contributing to the regulation of blood vessel formation and impacting vascular processes. In its role as a regulatory modulator of immune responses, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways (By similarity).

Verified Bioactivity

Measured by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. The ED50 for this effect is 0.3-1.0 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. The ED50 for this effect is 0.4007 μg/mL, corresponding to a specific activity is 2495.633 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    O00182-2 (M1-T323)

  • Gene ID
    3965  [NCBI]
  • Molecular Construction
    • N-term
    • LGALS9 (M1-T323)
      Accession # O00182-2
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-2

  • Synonyms

    LGALS9; Ecalectin; Galectin 9; Gal-9; LGALS9A; Urate Transporter/Channel Protein; Lectin, Galactoside-Binding, Soluble, 9; Galectin; Tumor Antigen HOM-HD-21; HUAT; Galectin-9

  • AA Sequence

    MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

  • Molecular Weight

    Approximately 45-55 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM His-HCl, 8% trehalose, 2% mannitol, 0.05% Tween 80, 1 mM EDTA, 1 mM DTT, pH 6.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5 mM DTT, 1 mM EDTA, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. The ED50 for this effect is 0.4007 μg/mL, corresponding to a specific activity is 2495.633 units/mg.

  • 1/16

    Galectin-9/LGALS9 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Life Sci. 2026 Mar 1:388:124173. [Abstract]

    Customer Validation
     Stimulation of IL-4 and IL-10 production by Gal-9 (Galectin-9/LGALS9) (1 μg/mL; 24-72 h) exogenously added to cultured PBMCs from early pregnant women. PBMCs were cultured with or without recombinant human Gal-9, and IL-4/IL-10 levels were measured at the indicated time points.

  • 1/16

    Galectin-9/LGALS9 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cancer Genet. 2025 Sep 10:298-299:141-150. [Abstract]

    Customer Validation
     Galectin-9/LGALS9 (Gal-9) (40 ng/mL; 48 h). The expression of Argnise-1, CD163, IL-10 and iNOS in THP-1 was detected by Western Blot.

  • 1/16

    Galectin-9/LGALS9 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cancer Genet. 2025 Sep 10:298-299:141-150. [Abstract]

    Customer Validation
     Galectin-9/LGALS9 (Gal-9) (40 ng/mL; 12 h). Co-IP assays were performed to examine the protein–protein interactions of Tim-3 with p85 and p110 with p85, respectively.

  • 1/16

    Galectin-9/LGALS9 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cancer Genet. 2025 Sep 10:298-299:141-150. [Abstract]

    Customer Validation
     Galectin-9/LGALS9 (Gal-9) (40 ng/mL; 48 h). Colocalization of Tim-3 and P85 or P110 and P85 was assayed by immunofluorescence detection. Bars, 5 μm.

  • 1/16

    Galectin-9/LGALS9 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cancer Genet. 2025 Sep 10:298-299:141-150. [Abstract]

    Customer Validation
     Expression of CD86 and CD163 on THP-1 cells treated with or without rhGal-9 (Galectin-9/LGALS9) (40 ng/mL; 24 h) protein was detected by flow cytometry.

  • 1/16

    Galectin-9/LGALS9 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cancer Genet. 2025 Sep 10:298-299:141-150. [Abstract]

    Customer Validation
     Galectin-9/LGALS9 (Gal-9) (40 ng/mL; 24 h). Proliferation of HTC116 and RKO was detected using CCK-8. The CCK-8 assay revealed that galectin-9-pretreated macrophages promoted the proliferation.

  • 1/16

    Galectin-9/LGALS9 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cancer Genet. 2025 Sep 10:298-299:141-150. [Abstract]

    Customer Validation
     Wound healing assay of HCT116. Bars, 200 μm. The results showed that Galectin-9 (Galectin-9/LGALS9) (40 ng/mL; 24 h)-pretreated macrophages promoted the migration.

  • Galectin-9/LGALS9 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Galectin-9/LGALS9 Protein, Human (HEK293, His)
  • Experimental Validation Results for Galectin-9/LGALS9 Protein, Human (HEK293, His)
  • Experimental Validation Results for Galectin-9/LGALS9 Protein, Human (HEK293, His)
  • Experimental Validation Results for Galectin-9/LGALS9 Protein, Human (HEK293, His)
  • Experimental Validation Results for Galectin-9/LGALS9 Protein, Human (HEK293, His)
  • Experimental Validation Results for Galectin-9/LGALS9 Protein, Human (HEK293, His)
  • Experimental Validation Results for Galectin-9/LGALS9 Protein, Human (HEK293, His)
  • Experimental Validation Results for Galectin-9/LGALS9 Protein, Human (HEK293, His)
  • Experimental Validation Results for Galectin-9/LGALS9 Protein, Human (HEK293, His)
  • Galectin-9/LGALS9 Protein, Human (HEK293, His) Product Image

  • Galectin-9/LGALS9 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Life Sci. 2026 Mar 1:388:124173. [Abstract]

    Stimulation of IL-4 and IL-10 production by Gal-9 (Galectin-9/LGALS9) (1 μg/mL; 24-72 h) exogenously added to cultured PBMCs from early pregnant women. PBMCs were cultured with or without recombinant human Gal-9, and IL-4/IL-10 levels were measured at the indicated time points.

  • Galectin-9/LGALS9 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cancer Genet. 2025 Sep 10:298-299:141-150. [Abstract]

    Galectin-9/LGALS9 (Gal-9) (40 ng/mL; 48 h). The expression of Argnise-1, CD163, IL-10 and iNOS in THP-1 was detected by Western Blot.

  • Galectin-9/LGALS9 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cancer Genet. 2025 Sep 10:298-299:141-150. [Abstract]

    Galectin-9/LGALS9 (Gal-9) (40 ng/mL; 12 h). Co-IP assays were performed to examine the protein–protein interactions of Tim-3 with p85 and p110 with p85, respectively.

  • Galectin-9/LGALS9 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cancer Genet. 2025 Sep 10:298-299:141-150. [Abstract]

    Galectin-9/LGALS9 (Gal-9) (40 ng/mL; 48 h). Colocalization of Tim-3 and P85 or P110 and P85 was assayed by immunofluorescence detection. Bars, 5 μm.

  • Galectin-9/LGALS9 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cancer Genet. 2025 Sep 10:298-299:141-150. [Abstract]

    Expression of CD86 and CD163 on THP-1 cells treated with or without rhGal-9 (Galectin-9/LGALS9) (40 ng/mL; 24 h) protein was detected by flow cytometry.

  • Galectin-9/LGALS9 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cancer Genet. 2025 Sep 10:298-299:141-150. [Abstract]

    Galectin-9/LGALS9 (Gal-9) (40 ng/mL; 24 h). Proliferation of HTC116 and RKO was detected using CCK-8. The CCK-8 assay revealed that galectin-9-pretreated macrophages promoted the proliferation.

  • Galectin-9/LGALS9 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cancer Genet. 2025 Sep 10:298-299:141-150. [Abstract]

    Wound healing assay of HCT116. Bars, 200 μm. The results showed that Galectin-9 (Galectin-9/LGALS9) (40 ng/mL; 24 h)-pretreated macrophages promoted the migration.