1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Inhibitory Checkpoint Molecules
  4. Galectin-9
  5. Galectin-9/LGALS9 Protein, Mouse (GST)

The Galectin-9/LGALS9 protein is an eosinophil chemoattractant that directs the migration of eosinophils, key immune cells in the inflammatory response.It also acts as an angiogenesis inhibitor, regulating blood vessel formation.Galectin-9/LGALS9 Protein, Mouse (GST) is the recombinant mouse-derived Galectin-9/LGALS9 protein, expressed by E.coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Galectin-9/LGALS9 Protein, Mouse (GST) Featured Recommendations:

Top Publications Citing Use of Products

2 Publications Citing Use of MCE Galectin-9/LGALS9 Protein, Mouse (GST)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Galectin-9/LGALS9 protein is an eosinophil chemoattractant that directs the migration of eosinophils, key immune cells in the inflammatory response.It also acts as an angiogenesis inhibitor, regulating blood vessel formation.Galectin-9/LGALS9 Protein, Mouse (GST) is the recombinant mouse-derived Galectin-9/LGALS9 protein, expressed by E.coli , with N-GST labeled tag.

Background

Galectin-9/LGALS9 protein functions as an eosinophil chemoattractant, playing a pivotal role in directing the migration of eosinophils, key immune cells involved in inflammatory responses. Additionally, this protein acts as an angiogenesis inhibitor, contributing to the regulation of blood vessel formation. Beyond its impact on cellular trafficking and vascular processes, Galectin-9/LGALS9 serves as a modulator of immune responses by suppressing interferon-gamma (IFNG) production in natural killer cells, thus exerting regulatory control over immune signaling pathways.

Species

Mouse

Source

E. coli

Tag

N-GST

Accession

O08573-2 (M1-T322)

Gene ID
Molecular Construction
N-term
GST
LGALS9 (M1-T322)
Accession # O08573-2
C-term
Protein Length

Full Length of Isoform-2

Synonyms
Galectin-9; Lgals9; Gal-9
AA Sequence

MALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQTQNFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT

Predicted Molecular Mass
62.8 kDa
Molecular Weight

Approximately 58-60 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Galectin-9/LGALS9 Protein, Mouse (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Galectin-9/LGALS9 Protein, Mouse (GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Galectin-9/LGALS9 Protein, Mouse (GST)
Cat. No.:
HY-P72637
Quantity:
MCE Japan Authorized Agent: