Galectin-9/LGALS9 Protein, Mouse (GST)

Galectin-9/LGALS9 Protein, an eosinophil chemoattractant, directs the migration of eosinophils, key immune cells in inflammatory responses. It also functions as an angiogenesis inhibitor, regulating blood vessel formation. Beyond cellular trafficking and vascular processes, Galectin-9/LGALS9 modulates immune responses by suppressing interferon-gamma (IFNG) production in natural killer cells, exerting regulatory control over immune signaling pathways. Galectin-9/LGALS9 Protein, Mouse (GST) is the recombinant mouse-derived Galectin-9/LGALS9 protein, expressed by E. coli, with N-GST labeled tag. The total length of Galectin-9/LGALS9 Protein, Mouse (GST) is 322 a.a., with molecular weight of ~60.0 kDa.

Galectin-9/LGALS9 protein functions as an eosinophil chemoattractant, playing a pivotal role in directing the migration of eosinophils, key immune cells involved in inflammatory responses. Additionally, this protein acts as an angiogenesis inhibitor, contributing to the regulation of blood vessel formation. Beyond its impact on cellular trafficking and vascular processes, Galectin-9/LGALS9 serves as a modulator of immune responses by suppressing interferon-gamma (IFNG) production in natural killer cells, thus exerting regulatory control over immune signaling pathways.

Mouse

E. coli

N-GST

O08573-2 (M1-T322)

16859  [NCBI]

MALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQTQNFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT

Approximately 60.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 20 mM PB, 1 mM EDTA, 5 mM p-ME, 5% Trehalose, 400 mM NaCl, pH 6.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.