Galectin-9/LGALS9 Protein, Mouse (GST)

The Galectin-9/LGALS9 protein is an eosinophil chemoattractant that directs the migration of eosinophils, key immune cells in the inflammatory response.It also acts as an angiogenesis inhibitor, regulating blood vessel formation.Galectin-9/LGALS9 Protein, Mouse (GST) is the recombinant mouse-derived Galectin-9/LGALS9 protein, expressed by E.coli , with N-GST labeled tag.

Galectin-9/LGALS9 protein functions as an eosinophil chemoattractant, playing a pivotal role in directing the migration of eosinophils, key immune cells involved in inflammatory responses. Additionally, this protein acts as an angiogenesis inhibitor, contributing to the regulation of blood vessel formation. Beyond its impact on cellular trafficking and vascular processes, Galectin-9/LGALS9 serves as a modulator of immune responses by suppressing interferon-gamma (IFNG) production in natural killer cells, thus exerting regulatory control over immune signaling pathways.

Mouse

E. coli

N-GST

O08573-2 (M1-T322)

16859  [NCBI]

Full Length of Isoform-2

MALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQTQNFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT

Approximately 58-60 kDa, based on SDS-PAGE under reducing conditions.

≥ 85%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 20 mM PB, 1 mM EDTA, 5 mM β-ME, 5% Trehalose, 400 mM NaCl, pH 6.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.