GLP1R Protein, Human (HEK293, N-His, C-Myc)

The GLP1R protein is a G protein-coupled receptor for glucagon-like peptide 1 (GLP-1), which upon ligand binding activates adenylyl cyclase and increases cAMP levels. This interaction critically regulates insulin secretion, affecting cellular responses and metabolic processes associated with GLP-1 signaling. GLP1R Protein, Human (HEK293, N-His, C-Myc) is the recombinant human-derived GLP1R protein, expressed by HEK293 , with C-Myc, N-10*His labeled tag. The total length of GLP1R Protein, Human (HEK293, N-His, C-Myc) is 122 a.a., with molecular weight of 19.3 kDa.

The GLP1R Protein functions as a G-protein coupled receptor for glucagon-like peptide 1 (GLP-1), participating in a signaling cascade upon ligand binding that activates adenylyl cyclase and increases intracellular cAMP levels. This molecular interaction plays a crucial role in regulating insulin secretion in response to GLP-1. The receptor's activation contributes to the modulation of cellular responses and metabolic processes associated with GLP-1 signaling. Notably, the allosteric modulators NNC0640, PF-06372222, and MK-0893 demonstrate inhibitory effects on the increase of intracellular cAMP levels in response to GLP-1, offering potential avenues for pharmacological intervention in this signaling pathway.

Human

HEK293

C-Myc;N-10*His

P43220 (R24-Y145)

2740  [NCBI]

RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

19.3 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.