1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins
  3. CSF & Receptors Macrophage CD Proteins Monocyte CD Proteins Endothelial cell CD Proteins Cytokine Receptors
  4. GM-CSFR GM-CSF R alpha/CD116
  5. GM-CSF R alpha
  6. GM-CSF R alpha Protein, Human (HEK293, Fc)

GM-CSF R alpha Protein, Human (HEK293, Fc)

Cat. No.: HY-P73083
COA Handling Instructions

GM-CSF R alpha is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2. GM-CSF R alpha binds to the cytokine with high specificity and low affinity. GM-CSF R alpha binds to GM-CSF and induces cell differentiation. GM-CSF R alpha monoclonal antibody decreases GM-CSFRα expression on GM-CSF-responsive cells and shows anti-inflammatory activity in rheumatoid arthritis (RA). GM-CSF R alpha Protein, Human (HEK293, Fc) is a recombinant protein with a C-Terminal Fc label, It consists of 320 amino acids (M1-G320) and is produced in HEK293 cells.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $60 In-stock
50 μg $165 In-stock
100 μg $280 In-stock
500 μg $900 In-stock
1 mg $1650 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

GM-CSF R alpha is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2. GM-CSF R alpha binds to the cytokine with high specificity and low affinity[1]. GM-CSF R alpha binds to GM-CSF and induces cell differentiation[2]. GM-CSF R alpha monoclonal antibody decreases GM-CSFRα expression on GM-CSF-responsive cells and shows anti-inflammatory activity in rheumatoid arthritis (RA)[3]. GM-CSF R alpha Protein, Human (HEK293, Fc) is a recombinant protein with a C-Terminal Fc label, It consists of 320 amino acids (M1-G320) and is produced in HEK293 cells.

Background

GM-CSF R alpha is expressed on myeloid cells and on some non-hemopoietic cells, such as endothelial cells, not on T cells[2].
The amino acid sequence of human GM-CSF R alpha protein has low homology for mouse GM-CSF R alpha protein.
GM-CSF receptor (GM-CSFR) consists of two subunits, an α-subunit, which binds the cytokine with low affinity, and a larger β-subunit (beta common; βc), responsible for signaling, forming a ternary receptor complex. Signal transduction in response to the cytokines interleukin (IL)-3 and IL-5 is also mediated by βc; therefore, receptor specificity is due to GM-CSFRα[1]. After binding GM-CSF to its receptor, Janus-kinase-2 (JAK-2) is recruited to the cytoplasmic domain of the β chain, and activation of JAK-2 occurs, which subsequently induces STAT-5 phosphorylation. This signaling pathway induces migration of STAT-5 dimers to the nucleus and promotes the transcription of various genes such as pim-1 and CIS to induce cell differentiation[2].
GM-CSFR α-subunit significantly increases positive synovial macrophages in the RA synovium. GM-CSFR α monoclonal antibody suppresses disease activity in the murine collagen-induced arthritis model[3].

Biological Activity

Measured by its ability to inhibit GM-CSF dependent proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is typically <15 μg/mL.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

P15509 (E23-G320)

Gene ID
Molecular Construction
N-term
GM-CSF R alpha (E23-G320)
Accession # P15509
hFc
C-term
Synonyms
Granulocyte-macrophage colony-stimulating factor receptor subunit alpha; GMR-alpha; CD116; CSF2RA; CSF2R; CSF2RY
AA Sequence

EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG

Molecular Weight

Approximately 90 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GM-CSF R alpha Protein, Human (HEK293, Fc)
Cat. No.:
HY-P73083
Quantity:
MCE Japan Authorized Agent: