1. Recombinant Proteins
  2. Cytokines and Growth Factors GMP-grade Proteins
  3. GMP OSM Protein, Human (His)

GMP OSM Protein, Human (His)

Cat. No.: HY-P70465G
SDS COA Handling Instructions

OSM protein is a multifunctional growth regulator with dual functions of inhibiting tumor cell lines and stimulating the proliferation of AIDS-KS cells. It coordinates the production of cytokines, including IL-6, G-CSF, and GM-CSF, and binds to type I and type II OSM receptors, forming heterodimers with LIFR/IL6ST and OSMR/IL6ST, respectively. GMP OSM Protein, Human (His) is the recombinant human-derived OSM protein, expressed by E. coli , with N-6*His labeled tag. The total length of GMP OSM Protein, Human (His) is 196 a.a., with molecular weight of ~28.0 kDa.

GMP-grade recombinant proteins are produced under independent QA supervision, as well as quality records and full traceability.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

OSM protein is a multifunctional growth regulator with dual functions of inhibiting tumor cell lines and stimulating the proliferation of AIDS-KS cells. It coordinates the production of cytokines, including IL-6, G-CSF, and GM-CSF, and binds to type I and type II OSM receptors, forming heterodimers with LIFR/IL6ST and OSMR/IL6ST, respectively. GMP OSM Protein, Human (His) is the recombinant human-derived OSM protein, expressed by E. coli , with N-6*His labeled tag. The total length of GMP OSM Protein, Human (His) is 196 a.a., with molecular weight of ~28.0 kDa.

Background

GMP OSM Protein stands as a versatile growth regulator with dual inhibitory effects on the proliferation of various tumor cell lines and stimulatory effects on AIDS-KS cell proliferation. Notably, OSM orchestrates the regulation of cytokine production, including IL-6, G-CSF, and GM-CSF from endothelial cells. This multifaceted growth regulator engages both the type I OSM receptor, forming heterodimers composed of LIFR and IL6ST, and the type II OSM receptor, forming heterodimers composed of OSMR and IL6ST. Beyond its antiproliferative and proliferative roles, OSM plays a crucial part in the maturation of fetal hepatocytes, contributing significantly to liver development and regeneration.

Biological Activity

Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.3287 ng/mL, corresponding to a specific activity is 3.042×106 units/mg.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P13725 (A26-R221)

Gene ID
Molecular Construction
N-term
6*His
GMP OSM (A26-R221)
Accession # P13725
C-term
Synonyms
Oncostatin-M; OSM
AA Sequence

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR

Molecular Weight

Approximately 28.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 1 mM EDTA, 200 mM NaCl, pH 7.5.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GMP OSM Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GMP OSM Protein, Human (His)
Cat. No.:
HY-P70465G
Quantity:
MCE Japan Authorized Agent: