GPVI Protein, Human (HEK293, His)
Based on 1 publication(s) in Google Scholar
GPVI protein is a collagen receptor that mediates collagen-induced platelet adhesion and activation and plays a crucial role in procoagulant activity, thrombin generation, and fibrin formation. GPVI Protein, Human (HEK293, His) is the recombinant human-derived GPVI protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
GPVI protein is a collagen receptor that mediates collagen-induced platelet adhesion and activation and plays a crucial role in procoagulant activity, thrombin generation, and fibrin formation. GPVI Protein, Human (HEK293, His) is the recombinant human-derived GPVI protein, expressed by HEK293 , with C-His labeled tag.
Background
The GPVI protein functions as a collagen receptor crucially involved in mediating collagen-induced platelet adhesion and activation. It plays a pivotal role in platelet procoagulant activity, leading to subsequent thrombin and fibrin formation, thereby contributing to arterial and venous thrombus formation. The signaling pathway involves the FcR gamma-chain, the Src kinases (likely FYN or LYN), SYK, the adapter protein LAT, and culminates in the activation of PLCG2. GPVI is associated with the Fc receptor gamma chain, forming the GPVI:FcRgamma complex that is further linked to the Src kinase family FYN and LYN. Additionally, GPVI interacts with TRAF4 and specifically binds to COL1A1, highlighting its involvement in intricate signaling cascades and its association with collagen molecules, particularly COL1A1, which is integral to its collagen-binding function.
Verified Bioactivity
1. Measured by its binding ability in a functional ELISA. When Bovine Collagen I is immobilized, Human GPVI binds with an ED50 of 0.4252 μg/mL, corresponding to a specific activity is 2.35×103 units/mg.
2. Immobilized Human GPVI, His Tag at 1 μg/ml (100μl/Well) on the plate. Dose response curve for Anti-GPVI Antibody, hFc Tag with the EC50 of <10 ng/ml determined by ELISA.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Trends Biotechnol
Biomimetic recombinant collagen with multicopy dual-targeted hemostatic motifs for enhanced hemostasis in surgical trauma. [Abstract]2026 Mar 18:S0167-7799(26)00037-5. PMID: 41856809
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-8*His
-
Accession
Q9HCN6-1 (Q21-K267)
-
Molecular Construction
-
N-term
-
GPVI (Q21-K267)
Accession # Q9HCN6-1 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
GP6; Glycoprotein VI (Platelet); Glycoprotein VI Platelet; Platelet Collagen Receptor; GPVI; BDPLT11; Platelet Glycoprotein VI; GPIV; Glycoprotein 6
-
AA Sequence
QSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTK
-
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE or Bis-Tris PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, 8% trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)