GPVI Protein, Human (HEK293, His)

GPVI protein is a collagen receptor that mediates collagen-induced platelet adhesion and activation and plays a crucial role in procoagulant activity, thrombin generation, and fibrin formation. GPVI Protein, Human (HEK293, His) is the recombinant human-derived GPVI protein, expressed by HEK293 , with C-His labeled tag. The total length of GPVI Protein, Human (HEK293, His) is 247 a.a., with molecular weight of 40-60 kDa.

The GPVI protein functions as a collagen receptor crucially involved in mediating collagen-induced platelet adhesion and activation. It plays a pivotal role in platelet procoagulant activity, leading to subsequent thrombin and fibrin formation, thereby contributing to arterial and venous thrombus formation. The signaling pathway involves the FcR gamma-chain, the Src kinases (likely FYN or LYN), SYK, the adapter protein LAT, and culminates in the activation of PLCG2. GPVI is associated with the Fc receptor gamma chain, forming the GPVI:FcRgamma complex that is further linked to the Src kinase family FYN and LYN. Additionally, GPVI interacts with TRAF4 and specifically binds to COL1A1, highlighting its involvement in intricate signaling cascades and its association with collagen molecules, particularly COL1A1, which is integral to its collagen-binding function.

Measured by its binding ability in a functional ELISA. When Bovine Collagen I is immobilized, Human GPVI binds with an ED₅₀ of 0.4252 μg/mL, corresponding to a specific activity is 2.35×10^3 units/mg.

• 
  Measured by its binding ability in a functional ELISA. When Bovine Collagen I is immobilized, Human GPVI binds with an ED₅₀ of 0.4252 μg/mL, corresponding to a specific activity is 2.35×10³ units/mg.

Human

HEK293

C-His

Q9HCN6 (Q21-K267)

51206  [NCBI]

QSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTK

40-60 kDa

• 
  Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.