GSK-3 beta Protein, Human (P. pastoris, His)

GSK-3 beta is an active protein kinase that regulates a variety of cellular processes. It negatively regulates glucose homeostasis, Wnt signaling, and transcription factors by phosphorylating substrates such as glycogen synthase, CTNNB1, and JUN. GSK-3 beta Protein, Human (P. pastoris, His) is the recombinant human-derived GSK-3 beta protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of GSK-3 beta Protein, Human (P. pastoris, His) is 420 a.a., with molecular weight of 48.7 kDa.

GSK-3 beta, a constitutively active protein kinase, plays a multifaceted role in regulating diverse cellular processes. It serves as a negative regulator in hormonal control of glucose homeostasis, Wnt signaling, and transcription factors, exerting its effects by phosphorylating and inactivating key substrates such as glycogen synthase, EIF2B, CTNNB1/beta-catenin, APC, AXIN1, DPYSL2/CRMP2, JUN, NFATC1/NFATC, MAPT/TAU, and MACF1. In skeletal muscle, it contributes to insulin regulation of glycogen synthesis. GSK-3 beta's involvement in Wnt signaling leads to CTNNB1 degradation, while its phosphorylation of JUN and NFATC1/NFATC modulates their activity. The kinase also plays crucial roles in microtubule dynamics, influencing MAPT/TAU stability and contributing to ERBB2-dependent microtubule stabilization. Additionally, GSK-3 beta participates in diverse pathways such as NF-kappa-B regulation, pancreatic beta-cell replication, and apoptosis control through interactions with MCL1 and SNAI1. Furthermore, it orchestrates circadian rhythms, autophagy, and extrinsic apoptotic signaling, highlighting its central role in cellular homeostasis and response to external stimuli.

Human

P. pastoris

N-6*His

P49841 (M1-T420)

2932  [NCBI]

MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST

48.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.