1. Recombinant Proteins
  2. Others
  3. HCVNS5B Protein, HCV

POLG proteins play multiple roles in the viral life cycle, contributing to viral RNA packaging, budding, and particle production. It exhibits RNA-binding and RNA chaperone activities, affecting translation initiation through interactions with viral IRES and ribosomal subunits. HCVNS5B Protein, HCV is the recombinant HCVNS5B, expressed by E. coli, with tag-free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

POLG proteins play multiple roles in the viral life cycle, contributing to viral RNA packaging, budding, and particle production. It exhibits RNA-binding and RNA chaperone activities, affecting translation initiation through interactions with viral IRES and ribosomal subunits. HCVNS5B Protein, HCV is the recombinant HCVNS5B, expressed by E. coli, with tag-free.

Background

The POLG protein plays a multifaceted role in the life cycle of the virus, contributing to various stages of viral replication and modulating host cellular processes. It is instrumental in packaging viral RNA to form the viral nucleocapsid, promoting virion budding, and participating in viral particle production through interaction with non-structural protein 5A. Additionally, POLG exhibits RNA-binding activity, suggesting a potential role as an RNA chaperone that induces structural rearrangements during virus replication. This versatile protein influences viral translation initiation by interacting with viral internal ribosomal entry site (IRES) and 40S ribosomal subunits. Beyond its direct involvement in viral processes, POLG impacts cell signaling pathways, host immunity, and lipid metabolism. It impedes the establishment of a cellular antiviral state by blocking interferon-alpha/beta and interferon-gamma signaling, inhibiting STAT1 phosphorylation, and promoting STAT1 degradation. Moreover, POLG activates STAT3, contributing to cellular transformation. The protein also regulates cellular gene activity, suppressing p53 promoter activity, sequestering CREB3 and SP110 isoform 3 in the cytoplasm, and repressing CDKN1A, thereby disrupting cell cycle regulation. POLG further influences transcription factors involved in inflammatory responses and the immune response, affecting NF-kappa-B activation and AP-1. Its interaction with dendritic cells down-regulates T-lymphocyte proliferation. In the context of lipid metabolism, POLG interacts with hepatocellular proteins to induce lipid accumulation and storage. Additionally, POLG forms a heterodimer with envelope glycoprotein E2, facilitating virus attachment, internalization, and fusion with the host membrane. The E1/E2 heterodimer's interaction with host apolipoproteins forms a lipo-viro-particle, allowing virus attachment to cell surface receptors and triggering HCV entry via activation of the EGFR signaling pathway.

Species

Others

Source

E. coli

Tag

Tag Free

Accession

O92972 (P1216-S1650)

Gene ID

/

Protein Length

Partial

Synonyms
Genome polyprotein; Hepatitis C virus genotype 1b (strain HC-J4); HCV; p23; Helicase; Hydrolase; Ion channel; Multifunctional enzyme; Nucleotidyltransferase; Protease; Ribonucleoprotein; RNA-binding; RNA-directed RNA polymerase; Serine protease; Thiol protease; Transferase; Viral ion channel; Viral nucleoprotein
AA Sequence

PPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGGSITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEIGLSNNGEIPFYGKAIPIEAIKGGRHLIFCHSKKKCDELAAKLTGLGLNAVAYYRGLDVSVIPPIGDVVVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRSGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVILTHPITKYIMACMS

Predicted Molecular Mass
46.6 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl (pH7.5), 200 mM NaCl, 20% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

HCVNS5B Protein, HCV Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

HCVNS5B Protein, HCV

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HCVNS5B Protein, HCV
Cat. No.:
HY-P703547
Quantity:
MCE Japan Authorized Agent: