Hemoglobin subunit zeta/HBAZ Protein, Human (His)

The hemoglobin zeta subunit (HBAZ) protein acts as an α-type chain in mammalian embryonic hemoglobin. It contributes to the formation of heterotetramers and is involved in various developmental stages. Hemoglobin subunit zeta/HBAZ Protein, Human (His) is the recombinant human-derived Hemoglobin subunit zeta/HBAZ protein, expressed by E. coli , with N-6*His labeled tag.

Hemoglobin subunit zeta (HBAZ) serves as an alpha-type chain within mammalian embryonic hemoglobin. It participates in distinct hemoglobin tetramers during various developmental stages, contributing to the formation of heterotetramers such as two zeta chains and two epsilon chains in early embryonic hemoglobin Gower-1. In fetal hemoglobin Portland-1, it combines with two zeta chains and two gamma chains, while in hemoglobin Portland-2, detected in fetuses and neonates with homozygous alpha-thalassemia, it forms a heterotetramer alongside two zeta chains and two beta chains.

Human

E. coli

N-6*His

P02008 (M1-R142)

3050  [NCBI]

Full Length

MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR

Approximately 15.0 kDa

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.