Hemoglobin subunit zeta/HBAZ Protein, Human (His)
The hemoglobin zeta subunit (HBAZ) protein acts as an α-type chain in mammalian embryonic hemoglobin. It contributes to the formation of heterotetramers and is involved in various developmental stages. Hemoglobin subunit zeta/HBAZ Protein, Human (His) is the recombinant human-derived Hemoglobin subunit zeta/HBAZ protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The hemoglobin zeta subunit (HBAZ) protein acts as an α-type chain in mammalian embryonic hemoglobin. It contributes to the formation of heterotetramers and is involved in various developmental stages. Hemoglobin subunit zeta/HBAZ Protein, Human (His) is the recombinant human-derived Hemoglobin subunit zeta/HBAZ protein, expressed by E. coli , with N-6*His labeled tag.
Background
Hemoglobin subunit zeta (HBAZ) serves as an alpha-type chain within mammalian embryonic hemoglobin. It participates in distinct hemoglobin tetramers during various developmental stages, contributing to the formation of heterotetramers such as two zeta chains and two epsilon chains in early embryonic hemoglobin Gower-1. In fetal hemoglobin Portland-1, it combines with two zeta chains and two gamma chains, while in hemoglobin Portland-2, detected in fetuses and neonates with homozygous alpha-thalassemia, it forms a heterotetramer alongside two zeta chains and two beta chains.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P02008 (M1-R142)
-
Molecular Construction
-
N-term
-
6*His
-
HBZ (M1-R142)
Accession # P02008 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
HBZ; HBZ1; Hemoglobin Subunit Zeta; Hemoglobin, Zeta; Hemoglobin Zeta Chain; HBAZ; Zeta-Globin; HBZ2; HBZ-T1
-
AA Sequence
MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR
-
Predicted Molecular Mass
17.8 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
