HGFA/HGF Activator Protein, Mouse (HEK293, His)

HGFA/HGF Activator Protein activates HGF by converting it to a heterodimeric form, crucial for cell growth, development, and tissue repair. It induces cellular responses like proliferation, migration, and differentiation. It regulates cell-matrix and cell-cell adhesion, morphology, and E-cadherin expression. It interacts with proteins including THSD1, PTK2/FAK1, TLN1, VCL, CTNNA1, APBB1IP, NRAP, CTNNB1, SYNM, SORBS1, and triggers conformational changes when binding to ACTN4, emphasizing its importance and therapeutic potential. HGFA/HGF Activator Protein, Mouse (HEK293, His) is the recombinant mouse-derived HGFA/HGF Activator protein, expressed by HEK293, with C-His, C-6*His labeled tag. The total length of HGFA/HGF Activator Protein, Mouse (HEK293, His) is 619 a.a., with molecular weight of approximately 107.5 kDa.

HGFA/HGF Activator Protein is responsible for activating hepatocyte growth factor (HGF) by converting it from a single chain to a heterodimeric form. This heterodimer consists of a short chain and a long chain that are linked together by a disulfide bond. HGFA/HGF Activator Protein plays a crucial role in various biological processes, including cell growth, development, and tissue repair. Its activation of HGF leads to the induction of cellular responses such as cell proliferation, migration, and differentiation. By modulating HGF activity, HGFA/HGF Activator Protein contributes to the regulation of cell-matrix adhesion, cell-cell adhesion, and cell morphology. It interacts with various proteins, including THSD1, PTK2/FAK1, TLN1, and VCL, and its association with CTNNA1 is essential for its localization to cell-cell junctions and the regulation of E-cadherin expression. Moreover, HGFA/HGF Activator Protein forms a complex with APBB1IP, NRAP, TLN1, CTNNB1, SYNM, SORBS1, and CTNNA1, and it triggers conformational changes when binding to ACTN4. Its multifaceted interactions and activities highlight its importance in cellular processes and underline its potential therapeutic applications.

Measured in a cell proliferation assay using hepG2 human hepatocellular carcinoma cells. The ED₅₀ for this effect is 0.951 μg/mL, corresponding to a specific activity is 5.126×10³ U/mg.

• 
  Measured in a cell proliferation assay using hepG2 human hepatocellular carcinoma cells. The ED₅₀ for this effect is 0.951 μg/mL, corresponding to a specific activity is 5.126×10³ U/mg.

Mouse

HEK293

C-His;C-6*His

Q9R098 (Q35-S653)

54426  [NCBI]

QAGRNHTEPPGPNVTATPVTPTIPVISGNVSTSTESAPAAETEGPQSERYPPPSSSSPPGGQVLTESGQPCRFPFRYGGRMLHSCTSEGSAYRKWCATTHNYDRDRAWGYCAEVTLPVEGPAILDPCASGPCLNGGTCSSTHDHGSYHCSCPLAFTGKDCGTEKCFDETRYEYFEVGDHWARVSEGHVEQCGCMEGQARCEDTHHTACLSSPCLNGGTCHLIVGTGTSVCTCPLGYAGRFCNIVPTEHCFLGNGTEYRGVASTAASGLSCLAWNSDLLYQELHVDSVAAAVLLGLGPHAYCRNPDKDERPWCYVVKDNALSWEYCRLTACESLARVHSQTPEILAALPESAPAVRPTCGKRHKKRTFLRPRIIGGSSSLPGSHPWLAAIYIGNSFCAGSLVHTCWVVSAAHCFANSPPRDSITVVLGQHFFNRTTDVTQTFGIEKYVPYTLYSVFNPNNHDLVLIRLKKKGERCAVRSQFVQPICLPEAGSSFPTGHKCQIAGWGHMDENVSSYSNSLLEALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLVCEKNGVAYLYGIISWGDGCGRLNKPGVYTRVANYVDWINDRIRPPKRPVATS

approximately 107.5 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris,150 mM NaCl, 2 mM CaCl₂, pH 8.0 or 20 mM PB, 150 mM NaCl, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.