HGFA/HGF Activator Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
HGFA/HGF activating proteins activate HGF by converting HGF into its heterodimeric form, which is critical for cell growth, development, and tissue repair. It induces cellular responses such as proliferation, migration, and differentiation. HGFA/HGF Activator Protein, Mouse (HEK293, His) is the recombinant mouse-derived HGFA/HGF Activator protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
HGFA/HGF activating proteins activate HGF by converting HGF into its heterodimeric form, which is critical for cell growth, development, and tissue repair. It induces cellular responses such as proliferation, migration, and differentiation. HGFA/HGF Activator Protein, Mouse (HEK293, His) is the recombinant mouse-derived HGFA/HGF Activator protein, expressed by HEK293 , with C-6*His labeled tag.
Background
HGFA/HGF Activator Protein is responsible for activating hepatocyte growth factor (HGF) by converting it from a single chain to a heterodimeric form. This heterodimer consists of a short chain and a long chain that are linked together by a disulfide bond. HGFA/HGF Activator Protein plays a crucial role in various biological processes, including cell growth, development, and tissue repair. Its activation of HGF leads to the induction of cellular responses such as cell proliferation, migration, and differentiation. By modulating HGF activity, HGFA/HGF Activator Protein contributes to the regulation of cell-matrix adhesion, cell-cell adhesion, and cell morphology. It interacts with various proteins, including THSD1, PTK2/FAK1, TLN1, and VCL, and its association with CTNNA1 is essential for its localization to cell-cell junctions and the regulation of E-cadherin expression. Moreover, HGFA/HGF Activator Protein forms a complex with APBB1IP, NRAP, TLN1, CTNNB1, SYNM, SORBS1, and CTNNA1, and it triggers conformational changes when binding to ACTN4. Its multifaceted interactions and activities highlight its importance in cellular processes and underline its potential therapeutic applications.
Verified Bioactivity
Measured in a cell proliferation assay using hepG2 human hepatocellular carcinoma cells. The ED50 for this effect is 0.951 μg/mL, corresponding to a specific activity is 5.126×103 U/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9R098 (Q35-S653)
-
Molecular Construction
-
N-term
-
HGFA (Q35-S653)
Accession # Q9R098 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
HGFAC; Serine Protease HGFAC; HGF Activator; HGFA Serine Protease; HGFA; HGFAP; Hepatocyte Growth Factor Activator Serine Protease; Hepatocyte Growth Factor Activator
-
AA Sequence
QAGRNHTEPPGPNVTATPVTPTIPVISGNVSTSTESAPAAETEGPQSERYPPPSSSSPPGGQVLTESGQPCRFPFRYGGRMLHSCTSEGSAYRKWCATTHNYDRDRAWGYCAEVTLPVEGPAILDPCASGPCLNGGTCSSTHDHGSYHCSCPLAFTGKDCGTEKCFDETRYEYFEVGDHWARVSEGHVEQCGCMEGQARCEDTHHTACLSSPCLNGGTCHLIVGTGTSVCTCPLGYAGRFCNIVPTEHCFLGNGTEYRGVASTAASGLSCLAWNSDLLYQELHVDSVAAAVLLGLGPHAYCRNPDKDERPWCYVVKDNALSWEYCRLTACESLARVHSQTPEILAALPESAPAVRPTCGKRHKKRTFLRPRIIGGSSSLPGSHPWLAAIYIGNSFCAGSLVHTCWVVSAAHCFANSPPRDSITVVLGQHFFNRTTDVTQTFGIEKYVPYTLYSVFNPNNHDLVLIRLKKKGERCAVRSQFVQPICLPEAGSSFPTGHKCQIAGWGHMDENVSSYSNSLLEALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLVCEKNGVAYLYGIISWGDGCGRLNKPGVYTRVANYVDWINDRIRPPKRPVATS
-
Molecular Weight
Approximately 80-100 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, 2 mM CaCl2, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, 2 mM CaCl2, pH 8.0, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (240 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
