1. Recombinant Proteins
  2. Others
  3. HLA-A Protein, Human (His)

HLA-A Protein, Human (His)

Cat. No.: HY-P72288
COA Handling Instructions

HLA-A protein is an antigen-presenting MHCI molecule that is critical for mediating reproductive and antiviral immunity. It partners with B2M to provide self- and viral peptides as ligands that inhibit and activate KIR on NK cells. HLA-A Protein, Human (His) is the recombinant human-derived HLA-A protein, expressed by E. coli , with N-6*His labeled tag. The total length of HLA-A Protein, Human (His) is 284 a.a., with molecular weight of ~36.7 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $58 In-stock
10 μg $145 In-stock
50 μg $305 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HLA-A protein is an antigen-presenting MHCI molecule that is critical for mediating reproductive and antiviral immunity. It partners with B2M to provide self- and viral peptides as ligands that inhibit and activate KIR on NK cells. HLA-A Protein, Human (His) is the recombinant human-derived HLA-A protein, expressed by E. coli , with N-6*His labeled tag. The total length of HLA-A Protein, Human (His) is 284 a.a., with molecular weight of ~36.7 kDa.

Background

HLA-C*0304, an antigen-presenting major histocompatibility complex class I (MHCI) molecule, plays a crucial role in both reproduction and antiviral immunity. In collaboration with B2M/beta 2 microglobulin, it exhibits a limited repertoire of self and viral peptides, serving as a prominent ligand for both inhibitory and activating killer immunoglobulin receptors (KIRs) expressed on natural killer (NK) cells. Particularly in the context of pregnancy, HLA-C*0304 mediates the interaction between extravillous trophoblasts and uterine NK cells through KIR, thereby regulating trophoblast invasion essential for placentation and overall fetal growth. During viral infections, it presents viral peptides with low affinity for KIRs, preventing KIR-mediated inhibition and promoting the lysis of infected cells. Furthermore, HLA-C*0304 displays a restricted repertoire of viral peptides on antigen-presenting cells, facilitating recognition by alpha-beta T cell receptors on CD8-positive T cells, thereby guiding antigen-specific T cell immune responses to eliminate infected cells, especially in chronic viral infection scenarios such as HIV-1 or CMV infection. The peptide and the MHC molecule jointly contribute to antigen recognition, with the peptide determining fine specificity, and MHC residues dictating T cell receptor restriction. Typically presenting intracellular peptide antigens of 9 amino acids originating from cytosolic proteolysis via the proteasome, HLA-C*0304 exhibits binding preferences for peptides with specific anchor residues at positions 2 and 9, mainly comprising hydrophobic or aromatic amino acids (Phe, Ile, Leu, Met, Val, and Tyr).

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P30443 (G25-I308)

Gene ID
Molecular Construction
N-term
6*His
HLA-A (G25-I308)
Accession # P30443
C-term
Synonyms
HLA class I histocompatibility antigen,A-1 alpha chain
AA Sequence

GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPI

Molecular Weight

Approximately 36.7 kDa

Purity
  • Greater than 91% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HLA-A Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HLA-A Protein, Human (His)
Cat. No.:
HY-P72288
Quantity:
MCE Japan Authorized Agent: